KEGG   Homo sapiens (human): 139760
Entry
139760            CDS       T01001                                 

Gene name
GPR119, GPCR2
Definition
(RefSeq) G protein-coupled receptor 119
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    139760 (GPR119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    139760 (GPR119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    139760 (GPR119)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    139760 (GPR119)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 139760
NCBI-ProteinID: NP_848566
OMIM: 300513
HGNC: 19060
Ensembl: ENSG00000147262
Vega: OTTHUMG00000022397
Pharos: Q8TDV5(Tchem)
UniProt: Q8TDV5
LinkDB
Position
Xq26.1
AA seq 335 aa
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG
LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF
VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL
FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP
FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggaatcatctttctcatttggagtgatccttgctgtcctggcctccctcatcattgct
actaacacactagtggctgtggctgtgctgctgttgatccacaagaatgatggtgtcagt
ctctgcttcaccttgaatctggctgtggctgacaccttgattggtgtggccatctctggc
ctactcacagaccagctctccagcccttctcggcccacacagaagaccctgtgcagcctg
cggatggcatttgtcacttcctccgcagctgcctctgtcctcacggtcatgctgatcacc
tttgacaggtaccttgccatcaagcagcccttccgctacttgaagatcatgagtgggttc
gtggccggggcctgcattgccgggctgtggttagtgtcttacctcattggcttcctccca
ctcggaatccccatgttccagcagactgcctacaaagggcagtgcagcttctttgctgta
tttcaccctcacttcgtgctgaccctctcctgcgttggcttcttcccagccatgctcctc
tttgtcttcttctactgcgacatgctcaagattgcctccatgcacagccagcagattcga
aagatggaacatgcaggagccatggctggaggttatcgatccccacggactcccagcgac
ttcaaagctctccgtactgtgtctgttctcattgggagctttgctctatcctggaccccc
ttccttatcactggcattgtgcaggtggcctgccaggagtgtcacctctacctagtgctg
gaacggtacctgtggctgctcggcgtgggcaactccctgctcaacccactcatctatgcc
tattggcagaaggaggtgcgactgcagctctaccacatggccctaggagtgaagaaggtg
ctcacctcattcctcctctttctctcggccaggaattgtggcccagagaggcccagggaa
agttcctgtcacatcgtcactatctccagctcagagtttgatggctaa

DBGET integrated database retrieval system