KEGG   Homo sapiens (human): 1434
Entry
1434              CDS       T01001                                 

Gene name
CSE1L, CAS, CSE1, XPO2
Definition
(RefSeq) chromosome segregation 1 like
  KO
K18423  exportin-2 (importin alpha re-exporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1434 (CSE1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1434 (CSE1L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    1434 (CSE1L)
SSDB
Motif
Pfam: CAS_CSE1 Cse1 IBN_N Xpo1
Other DBs
NCBI-GeneID: 1434
NCBI-ProteinID: NP_001307
OMIM: 601342
HGNC: 2431
Ensembl: ENSG00000124207
Vega: OTTHUMG00000033046
Pharos: P55060(Tbio)
UniProt: P55060 A0A384NKW7
LinkDB
Position
20q13.13
AA seq 971 aa
MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKV
CASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR
EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAF
ALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMN
NFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEE
AFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP
SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVL
KADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATL
FTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQEFI
PYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSNTIA
SAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQN
SKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK
ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ
TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQ
GYLQAASVTLL
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggaactcagcgatgcaaatctgcaaacactaacagaatatttaaagaaaacacttgat
cctgatcctgccatccgacgtccagctgagaaatttcttgaatctgttgaaggaaatcag
aattatccactgttgcttttgacattactggagaagtcccaggataatgttatcaaagta
tgtgcttcagtaacattcaaaaactatattaaaaggaactggagaattgttgaagatgaa
ccaaacaaaatttgtgaagccgatcgagtggccattaaagccaacatagtgcacttgatg
cttagcagcccagagcaaattcagaagcagttaagtgatgcaattagcattattggcaga
gaagattttccacagaaatggcctgacttgctgacagaaatggtgaatcgctttcagagt
ggagatttccatgttattaatggagtcctccgtacagcacattcattatttaaaagatac
cgtcatgaatttaagtcaaacgagttatggactgaaattaagcttgttctggatgccttt
gctttgcctttgactaatctttttaaggccactattgaactctgcagtacccatgcaaat
gatgcctctgccctgaggattctgttttcttccctgatcctgatctcaaaattgttctat
agtttaaactttcaggatctccctgaattttttgaagataatatggaaacttggatgaat
aattttcatactctcttaacattggataataagcttttacaaactgatgatgaagaggaa
gccggcttattggagctcttaaaatcccagatttgtgataatgccgcactctatgcacaa
aagtacgatgaagaattccagcgatacctgcctcgttttgttacagccatctggaattta
ctagttacaacgggtcaagaggttaaatatgatttgttggtaagtaatgcaattcaattt
ctggcttcagtttgtgagagacctcattataagaatctatttgaggaccagaacacgctg
acaagtatctgtgaaaaggttattgtgcctaacatggaatttagagctgctgatgaagaa
gcatttgaagataattctgaggagtacataaggagagatttggaaggatctgatattgat
actagacgcagggctgcttgtgatctggtacgaggattatgcaagttttttgagggacct
gtgacaggaatcttctctggttatgttaattccatgctgcaggaatacgcaaaaaatcca
tctgtcaactggaaacacaaagatgcagccatctacctagtgacatctttggcatcaaaa
gcccaaacacagaagcatggaattacacaagcaaatgaacttgtaaacctaactgagttc
tttgtgaatcacatcctccctgatttaaaatcagctaatgtgaatgaatttcctgtcctt
aaagctgacggtatcaaatatattatgatttttagaaatcaagtgccaaaagaacatctt
ttagtctcgattcctctcttgattaatcatcttcaagctgaaagtattgttgttcatact
tacgcagctcatgctcttgaacggctctttactatgcgagggcctaacaatgccactctc
tttacagctgcagaaatcgcaccgtttgttgagattctgctaacaaaccttttcaaagct
ctcacacttcctggctcttcagaaaatgaatatattatgaaagctatcatgagaagtttt
tctctcctacaagaagccataatcccctacatccctactctcatcactcagcttacacag
aagctattagctgttagtaagaacccaagcaaacctcactttaatcactacatgtttgaa
gcaatatgtttatccataagaataacttgcaaagctaaccctgctgctgttgtaaatttt
gaggaggctttgtttttggtgtttactgaaatcttacaaaatgatgtgcaagaatttatt
ccatacgtctttcaagtgatgtctttgcttctggaaacacacaaaaatgacatcccgtct
tcctatatggccttatttcctcatctccttcagccagtgctttgggaaagaacaggaaat
attcctgctctagtgaggcttcttcaagcattcttagaacgcggttcaaacacaatagca
agtgctgcagctgacaaaattcctgggttactaggtgtctttcagaagctgattgcatcc
aaagcaaatgaccaccaaggtttttatcttctaaacagtataatagagcacatgcctcct
gaatcagttgaccaatataggaaacaaatcttcattctgctattccagagacttcagaat
tccaaaacaaccaagtttatcaagagttttttagtctttattaatttgtattgcataaaa
tatggggcactagcactacaagaaatatttgatggtatacaaccaaaaatgtttggaatg
gttttggaaaaaattattattcctgaaattcagaaggtatctggaaatgtagagaaaaag
atctgtgcggttggcataaccaaattactaacagaatgtcccccaatgatggacactgag
tataccaaactgtggactccattattacagtctttgattggtctttttgagttacccgaa
gatgataccattcctgatgaggaacattttattgacatagaagatacaccaggatatcag
actgccttctcacagttggcatttgctgggaaaaaagagcatgatcctgtaggtcaaatg
gtgaataaccccaaaattcacctggcacagtcacttcacaagttgtctaccgcctgtcca
ggaagggttccatcaatggtgagcaccagcctgaatgcagaagcgctccagtatctccaa
gggtaccttcaggcagccagtgtgacactgctttaa

DBGET integrated database retrieval system