KEGG   Homo sapiens (human): 1436Help
Entry
1436              CDS       T01001                                 

Gene name
CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
Disease
H00028  Choriocarcinoma
H01807  Hereditary diffuse leukoencephalopathy with spheroids
Drug target
Edicotinib (DG03000): D11378 D11379
Emactuzumab: D11234
Mirimostim: D02664
Pexidartinib (DG02960): D11270 D11271
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1436 (CSF1R)
   04015 Rap1 signaling pathway
    1436 (CSF1R)
   04010 MAPK signaling pathway
    1436 (CSF1R)
   04151 PI3K-Akt signaling pathway
    1436 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1436 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1436 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1436 (CSF1R)
  09158 Development
   04380 Osteoclast differentiation
    1436 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1436 (CSF1R)
   05202 Transcriptional misregulation in cancer
    1436 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1436 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1436 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1436 (CSF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1436 (CSF1R)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   1436 (CSF1R)
CD molecules [BR:hsa04090]
 Proteins
  1436 (CSF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig Ig_2 I-set Izumo-Ig C2-set_2
Motif
Other DBs
NCBI-GeneID: 1436
NCBI-ProteinID: NP_001275634
OMIM: 164770
HGNC: 2433
Ensembl: ENSG00000182578
Vega: OTTHUMG00000130050
Pharos: P07333(Tclin)
UniProt: P07333
LinkDB All DBs
Structure
PDB: 

Position
5q32
AA seq 972 aa AA seqDB search
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttg
cgatgtgtgggcaatggcagcgtggaatgggatggccccccatcacctcactggaccctg
tactctgatggctccagcagcatcctcagcaccaacaacgctaccttccaaaacacgggg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctat
gtcaaagaccctgcccggccctggaacgtgctagcacaggaggtggtcgtgttcgaggac
caggacgcactactgccctgtctgctcacagacccggtgctggaagcaggcgtctcgctg
gtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcat
ggcttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctg
atgggtggcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgcagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcagcgttgatgttaactttgatgtcttcctccaacacaac
aacaccaagctcgcaatccctcaacaatctgactttcataataaccgttaccaaaaagtc
ctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctac
ttgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcccaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagagctctgacgtttgagctcacccttcgatac
cccccagaggtaagcgtcatatggacattcatcaacggctctggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgatagg
tgtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccag
gagcccttccacaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaac
caaacctacgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccacacgcatcccccggatgagttcctcttcacaccagtggtggtc
gcctgcatgtccatcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacg
gcctttggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaggaggccctcatgtccgagctgaagatcatgagccacctg
ggccagcacgagaacatcgtcaaccttctgggagcctgtacccatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccccggccaggaccccgagggaggcgtcgactataag
aacatccacctcgagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggca
gcgcgtaacgtgctgttgaccaatggtcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacattgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccaccttccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagag
cgggactataccaatctgccgagcagcagcagaagcggtggcagcggcagcagcagcagt
gagctggaggaggagagctctagtgagcacctgacctgctgcgagcaaggggatatcgcc
cagcccttgctgcagcccaacaactatcagttctgctga

KEGG   Homo sapiens (human): 4353Help
Entry
4353              CDS       T01001                                 

Gene name
MPO
Definition
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
hsa04145  Phagosome
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Disease
H00101  Other phagocyte defects
H02025  Myeloperoxidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4353 (MPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4353 (MPO)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4353 (MPO)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    4353 (MPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4353 (MPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     4353 (MPO)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4353 (MPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 4353
NCBI-ProteinID: NP_000241
OMIM: 606989
HGNC: 7218
Ensembl: ENSG00000005381
Vega: OTTHUMG00000178922
Pharos: P05164(Tchem)
UniProt: P05164
LinkDB All DBs
Structure
PDB: 

Position
17q22
AA seq 745 aa AA seqDB search
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcccttcttctcttctctcagatgcatggtggacttaggaccttgctgggct
gggggtctcactgcagagatgaagctgcttctggccctagcagggctcctggccattctg
gccacgccccagccctctgaaggtgctgctccagctgtcctgggggaggtggacacctcg
ttggtgctgagctccatggaggaggccaagcagctggtggacaaggcctacaaggagcgg
cgggaaagcatcaagcagcggcttcgcagcggctcagccagccccatggaactcctatcc
tacttcaagcagccggtggcagccaccaggacggcggtgagggccgctgactacctgcac
gtggctctagacctgctggagaggaagctgcggtccctgtggcgaaggccattcaatgtc
actgatgtgctgacgcccgcccagctgaatgtgttgtccaagtcaagcggctgcgcctac
caggacgtgggggtgacttgcccggagcaggacaaataccgcaccatcaccgggatgtgc
aacaacagacgcagccccacgctgggggcctccaaccgtgcctttgtgcgctggctgccg
gcggagtatgaggacggcttctctcttccctacggctggacgcccggggtcaagcgcaac
ggcttcccggtggctctggctcgcgcggtctccaacgagatcgtgcgcttccccactgat
cagctgactccggaccaggagcgctcactcatgttcatgcaatggggccagctgttggac
cacgacctcgacttcacccctgagccggccgcccgggcctccttcgtcactggcgtcaac
tgcgagaccagctgcgttcagcagccgccctgcttcccgctcaagatcccgcccaatgac
ccccgcatcaagaaccaagccgactgcatcccgttcttccgctcctgcccggcttgcccc
gggagcaacatcaccatccgcaaccagatcaacgcgctcacttccttcgtggacgccagc
atggtgtacggcagcgaggagcccctggccaggaacctgcgcaacatgtccaaccagctg
gggctgctggccgtcaaccagcgcttccaagacaacggccgggccctgctgccctttgac
aacctgcacgatgacccctgtctcctcaccaaccgctcagcgcgcatcccctgcttcctg
gcaggggacacccgttccagtgagatgcccgagctcacctccatgcacaccctcttactt
cgggagcacaaccggctggccacagagctcaagagcctgaaccctaggtgggatggggag
aggctctaccaggaagcccggaagatcgtgggggccatggtccagatcatcacttaccgg
gactacctgcccctggtgctggggccaacggccatgaggaagtacctgcccacgtaccgt
tcctacaatgactcagtggacccacgcatcgccaacgtcttcaccaatgccttccgctac
ggccacaccctcatccaacccttcatgttccgcctggacaatcggtaccagcccatggaa
cccaacccccgtgtccccctcagcagggtcttttttgcctcctggagggtcgtgctggaa
ggtggcattgaccccatcctccggggcctcatggccacccctgccaagctgaatcgtcag
aaccaaattgcagtggatgagatccgggagcgattgtttgagcaggtcatgaggattggg
ctggacctgcctgctctgaacatgcagcgcagcagggaccacggcctcccaggatacaat
gcctggaggcgcttctgtgggctcccgcagcctgaaactgtgggccagctgggcacggtg
ctgaggaacctgaaattggcgaggaaactgatggagcagtatggcacgcccaacaacatc
gacatctggatgggcggcgtgtccgagcctctgaagcgcaaaggccgcgtgggcccactc
ctcgcctgcatcatcggtacccagttcaggaagctccgggatggtgatcggttttggtgg
gagaacgagggtgtgttcagcatgcagcagcgacaggccctggcccagatctcattgccc
cggatcatctgcgacaacacaggcatcaccaccgtgtctaagaacaacatcttcatgtcc
aactcatatccccgggactttgtcaactgcagtacacttcctgcattgaacctggcttcc
tggagggaagcctcctag

KEGG   Homo sapiens (human): 1437Help
Entry
1437              CDS       T01001                                 

Gene name
CSF2, CSF, GMCSF
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05323  Rheumatoid arthritis
Network
nt06110  MAPK signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
N00187  KSHV Kaposin B to p38 signaling pathway
Drug target
Gimsilumab: D11121
Lenzilumab: D11236
Otilimab: D11343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1437 (CSF2)
   04668 TNF signaling pathway
    1437 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1437 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1437 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    1437 (CSF2)
   04660 T cell receptor signaling pathway
    1437 (CSF2)
   04657 IL-17 signaling pathway
    1437 (CSF2)
   04664 Fc epsilon RI signaling pathway
    1437 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1437 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1437 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    1437 (CSF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1437 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1437 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1437 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1437 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1437 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1437 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1437 (CSF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     1437 (CSF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1437 (CSF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   1437 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF
Motif
Other DBs
NCBI-GeneID: 1437
NCBI-ProteinID: NP_000749
OMIM: 138960
HGNC: 2434
Ensembl: ENSG00000164400
Vega: OTTHUMG00000059637
Pharos: P04141(Tbio)
UniProt: P04141
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 144 aa AA seqDB search
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtga

KEGG   Homo sapiens (human): 3562Help
Entry
3562              CDS       T01001                                 

Gene name
IL3, IL-3, MCGF, MULTI-CSF
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04664  Fc epsilon RI signaling pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05310  Asthma
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06240  Transcription
nt06266  Non-small cell lung cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3562 (IL3)
   04151 PI3K-Akt signaling pathway
    3562 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3562 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3562 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3562 (IL3)
   04664 Fc epsilon RI signaling pathway
    3562 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3562 (IL3)
   05202 Transcriptional misregulation in cancer
    3562 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    3562 (IL3)
  09163 Immune disease
   05310 Asthma
    3562 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3562 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3562 (IL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3562 (IL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3562 (IL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL3 Ldl_recept_b
Motif
Other DBs
NCBI-GeneID: 3562
NCBI-ProteinID: NP_000579
OMIM: 147740
HGNC: 6011
Ensembl: ENSG00000164399
Vega: OTTHUMG00000059640
Pharos: P08700(Tbio)
UniProt: P08700
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 152 aa AA seqDB search
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccaactcctggtccgccccggactccaagct
cccatgacccagacaacgcccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaaaatctc
ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccatatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgcg
caggctcaacagacgactttgagcctcgcgatcttttga

DBGET integrated database retrieval system