KEGG   Homo sapiens (human): 1447Help
Entry
1447              CDS       T01001                                 

Gene name
CSN2, CASB
Definition
(RefSeq) casein beta
  KO
K17107  beta-casein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    1447 (CSN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1447 (CSN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1447 (CSN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Casein
Motif
Other DBs
NCBI-GeneID: 1447
NCBI-ProteinID: NP_001882
OMIM: 115460
HGNC: 2447
Ensembl: ENSG00000135222
Vega: OTTHUMG00000129409
Pharos: P05814(Tbio)
UniProt: P05814 W5RWE1
LinkDB All DBs
Position
4q13.3
AA seq 226 aa AA seqDB search
MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQ
PQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKS
PTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIP
QQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcctcatcctcgcctgcctggtggctcttgctcttgcaagggagaccatagaa
agcctttcaagcagtgaggaatctattacagaatacaagcagaaagttgagaaggttaaa
catgaggaccagcagcaaggagaggatgaacaccaggataaaatctacccctctttccag
ccacagcctctgatctatccattcgttgaacctatcccctatggttttcttccacaaaac
attctgcctcttgctcagcctgctgtggtgctgcctgtccctcagcctgaaataatggaa
gtccctaaagctaaagacactgtctacactaagggcagagtgatgcctgtccttaaatct
ccaacgatacccttttttgaccctcaaatcccaaaactcactgatcttgaaaatctgcat
cttcctctgcctctgctccagcccttgatgcagcaggtccctcagcctattcctcagact
cttgcacttccccctcagcccctgtggtctgttcctcagcccaaagtcctgcctatcccc
cagcaagtggtgccctaccctcagagagctgtgcctgttcaagcccttctgctcaaccaa
gaacttctacttaaccccacccaccagatctaccctgtgactcagccacttgccccagtt
cataaccccattagtgtctaa

DBGET integrated database retrieval system