KEGG   Homo sapiens (human): 144715Help
Entry
144715            CDS       T01001                                 

Gene name
RAD9B
Definition
(RefSeq) RAD9 checkpoint clamp component B
  KO
K10995  cell cycle checkpoint control protein RAD9B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    144715 (RAD9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    144715 (RAD9B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    144715 (RAD9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad9
Motif
Other DBs
NCBI-GeneID: 144715
NCBI-ProteinID: NP_689655
OMIM: 608368
HGNC: 21700
Ensembl: ENSG00000151164
Vega: OTTHUMG00000152952
Pharos: Q6WBX8(Tdark)
UniProt: Q6WBX8 J3KPN7
LinkDB All DBs
Position
12q24.11
AA seq 429 aa AA seqDB search
MAAMLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPV
FFQHYQWSALVKMSENELDTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCK
VVIQFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVT
LAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFS
EATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDL
IEKKAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESS
VSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNG
SDAKYFCII
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatgctgaagtgcgtgatgagcggcagtcaggtgaaagtatttgggaaagca
gttcaagctctatcacgaattagtgacgagttctggctagacccatctaaaaaaggtctt
gctctaagatgtgtgaattcttctcggtcagcatatggatgtgtcctgttctctcctgtg
ttttttcagcattatcaatggtcagctttagtgaaaatgagtgaaaatgaacttgacaca
acactgcatttaaaatgcaaattgggaatgaagtcaattttgcccatctttagatgtctg
aattcccttgaaagaaatatagagaagtgcagaatattcaccagatctgataaatgcaaa
gtagttattcaattcttctacagacatggtattaaaagaactcataatatatgttttcaa
gaaagtcagcctttgcaagttatttttgacaagaatgtttgtactaatacgctaatgatt
caaccaagattgcttgctgatgccattgttctttttacatcaagtcaagaggaagttact
cttgctgttactccactgaatttttgcctcaagagttctaatgaggaatcaatggatttg
agcaatgctgtacacagtgagatgtttgttggctcagatgagtttgacttctttcaaatt
ggaatggacactgagataacattttgtttcaaagaattgaagggaatactgacattttca
gaagctacacatgctcctatatccatttattttgatttccctgggaaacctctggctttg
agtattgatgatatgttagtggaagctaactttattttggccacattagctgatgaacaa
agtagagcatcttcaccacagtcactgtgtctttcacagaaacgaaaaaggtcagatctg
attgaaaaaaaggctggcaaaaatgtaactggccaggccctggaatgtatttcaaaaaaa
gcagcaccaagaaggctttatcctaaggagactctcacaaacatatctgcattggaaaac
tgtggcagccctgcaatgaaaagagtggatggagatgtcagtgaagtatcagaaagcagt
gtcagcaacacagaggaagtgccagggtctctgtgtctcagaaagttttcttgcatgttc
tttggagcagtttcttctgaccagcaagaacacttcaaccaccctttcgacagtctggca
agagcaagtgacagtgaagaggacatgaataatgtgtgctgcaggaaagaatttaatgga
agtgatgccaaatatttctgtattatctga

DBGET integrated database retrieval system