KEGG   Homo sapiens (human): 145226
Entry
145226            CDS       T01001                                 

Gene name
RDH12, LCA13, RP53, SDR7C2
Definition
(RefSeq) retinol dehydrogenase 12
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Disease
H00837  Leber congenital amaurosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    145226 (RDH12)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     145226 (RDH12)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR AdoHcyase_NAD Epimerase NAD_binding_10 Glyco_trans_4_2 GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 145226
NCBI-ProteinID: NP_689656
OMIM: 608830
HGNC: 19977
Ensembl: ENSG00000139988
Vega: OTTHUMG00000170032
Pharos: Q96NR8(Tbio)
UniProt: Q96NR8 A0A0S2Z613
LinkDB
Position
14q24.1
AA seq 316 aa
MLVTLGLLTSFFSFLYMVAPSIRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELA
SRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLH
ILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHI
GKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRH
SSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTA
ERLWNVSCELLGIRWE
NT seq 951 nt   +upstreamnt  +downstreamnt
atgctggtcaccttgggactgctcacctccttcttctcgttcctgtatatggtagctcca
tccatcaggaagttctttgctggtggagtgtgtagaacaaatgtgcagcttcctggcaag
gtagtggtgatcactggcgccaacacgggcattggcaaggagacggccagagagctcgct
agccgaggagcccgagtctatattgcctgcagagatgtactgaagggggagtctgctgcc
agtgaaatccgagtggatacaaagaactcccaggtgctggtgcggaaattggacctatcc
gacaccaaatctatccgagcctttgctgagggctttctggcagaggaaaagcagctccat
attctgatcaacaatgcgggagtaatgatgtgtccatattccaagacagctgatggcttt
gaaacccacctgggagtcaaccacctgggccacttcctcctcacctacctgctcctggag
cggctaaaggtgtctgcccctgcacgggtggttaatgtgtcctcggtggctcaccacatt
ggcaagattcccttccacgacctccagagcgagaagcgctacagcaggggttttgcctat
tgccacagcaagctggccaatgtgctttttactcgtgagctggccaagaggctccaaggc
accggggtcaccacctacgcagtgcacccaggcgtcgtccgctctgagctggtccggcac
tcctccctgctctgcctgctctggcggctcttctccccctttgtcaagacggcacgggag
ggggcgcagaccagcctgcactgcgccctggctgagggcctggagcccctgagtggcaag
tacttcagtgactgcaagaggacctgggtgtctccaagggcccgaaataacaaaacagct
gagcgcctatggaatgtcagctgtgagcttctaggaatccggtgggagtag

KEGG   Homo sapiens (human): 157506
Entry
157506            CDS       T01001                                 

Gene name
RDH10, SDR16C4
Definition
(RefSeq) retinol dehydrogenase 10
  KO
K11151  retinol dehydrogenase 10 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    157506 (RDH10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     157506 (RDH10)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 157506
NCBI-ProteinID: NP_742034
OMIM: 607599
HGNC: 19975
Ensembl: ENSG00000121039
Vega: OTTHUMG00000164492
Pharos: Q8IZV5(Tbio)
UniProt: Q8IZV5 A0A024R7X6
LinkDB
Position
8q21.11
AA seq 341 aa
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF
LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaacatcgtggtggagttcttcgtggtcactttcaaagtgctctgggcgttcgtgctg
gccgcggcgcgctggctggtgcggcccaaggagaagagcgtggcgggccaggtgtgcctc
atcaccggcgccggcagcggcctgggccgcctcttcgcgctggagttcgcccggcgtcgg
gcgctgctggtgctgtgggacatcaacacgcaaagcaacgaggagacggctggcatggtg
cgccacatctaccgcgacctggaggcggccgacgccgctgcgctgcaagctgggaatggt
gaggaagaaattctgccccactgtaacttgcaggtttttacctacacctgtgacgtgggg
aagagggagaacgtctacctgacggctgaaagagtccgcaaggaggttggcgaagtctca
gtcctggtcaataatgctggtgtggtctctgggcatcaccttctggaatgtcctgatgag
ctcattgagagaaccatgatggtcaattgccatgcacacttctggaccactaaggctttt
cttcctacgatgctggagattaatcatggtcatattgtgacagttgcaagttccttggga
ttgttcagtactgccggagttgaggattactgtgccagtaaatttggagttgtgggtttt
catgaatccctgagccatgaactaaaggctgctgaaaaggatggaattaaaacaaccttg
gtttgcccttatcttgtagacactggcatgttcagaggctgccgaatcaggaaagaaatt
gagccttttctgccacctctgaagcctgattactgtgtgaagcaggccatgaaggccatc
ctcactgaccagcccatgatctgcactccccgcctcatgtacatcgtgaccttcatgaag
agcatcctaccatttgaagcagttgtgtgcatgtatcggttcctaggagcggacaagtgt
atgtacccctttattgctcaaagaaagcaagccacaaacaataatgaagcaaaaaatgga
atctaa

KEGG   Homo sapiens (human): 50700
Entry
50700             CDS       T01001                                 

Gene name
RDH8, PRRDH, SDR28C2
Definition
(RefSeq) retinol dehydrogenase 8
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    50700 (RDH8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     50700 (RDH8)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b DUF1776
Other DBs
NCBI-GeneID: 50700
NCBI-ProteinID: NP_056540
OMIM: 608575
HGNC: 14423
Ensembl: ENSG00000080511
Vega: OTTHUMG00000180392
Pharos: Q9NYR8(Tbio)
UniProt: Q9NYR8 K7ELF7
LinkDB
Position
19p13.2
AA seq 311 aa
MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTL
TVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVR
LVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFI
SLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQ
AIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLS
CGCLPTRVRPR
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccgctgcaccccggactgtgttgatctccggctgctcatcaggaattggtctggaa
cttgcagtgcaactggcccatgaccccaagaagcgctaccaggtcgtggccaccatgagg
gacctggggaagaaggagacactggaggcagctgctggggaggctctggggcagaccctc
accgtggcccagctggacgtgtgcagtgatgagtcggtggcccagtgtctcagctgtatc
cagggagaagtggacgtgctggtgaataatgctggaatgggcctggtggggcccctggag
gggctcagccttgctgccatgcagaatgtctttgacaccaactttttcggagctgtccgt
ctcgtcaaagctgtgcttccaggcatgaagaggaggcggcagggccacatcgtggtgatc
agcagtgtcatgggcctgcagggtgtcatcttcaacgatgtctatgcagcttccaagttc
gccctggagggattcttcgaaagcctcgctatccagctgctgcagttcaacatcttcatc
tccctggtggagccaggccccgtggtcaccgagtttgaggggaagcttctggcgcaggtt
tctatggctgagttcccaggcactgaccctgagaccctgcactacttccgggacctctat
ctcccagcctccaggaagctgttttgctccgtgggacagaacccacaggacgtggttcag
gccattgtcaacgtcatcagctcgactcgaccacccctgcgccgacagaccaacatccgc
tactcgccgctgaccacgctcaaaaccgtggattcctctggcagcctgtatgtgcgaacg
acccaccgcctcctcttccgctgtccacgcctcctcaaccttggccttcaatgtctgtcc
tgcggctgcctcccaacgcgggtgcggccaagatga

KEGG   Homo sapiens (human): 51109
Entry
51109             CDS       T01001                                 

Gene name
RDH11, ARSDR1, CGI82, HCBP12, MDT1, PSDR1, RALR1, RDJCSS, SCALD, SDR7C1
Definition
(RefSeq) retinol dehydrogenase 11
  KO
K11152  retinol dehydrogenase 11 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Disease
H02292  Retinal dystrophy, juvenile cataracts, and short stature syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    51109 (RDH11)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     51109 (RDH11)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase AdoHcyase_NAD Shikimate_DH
Other DBs
NCBI-GeneID: 51109
NCBI-ProteinID: NP_057110
OMIM: 607849
HGNC: 17964
Ensembl: ENSG00000072042
Vega: OTTHUMG00000171196
Pharos: Q8TC12(Tbio)
UniProt: Q8TC12 A0A0S2Z583
LinkDB
Position
14q24.1
AA seq 318 aa
MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKE
LAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKH
LHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAH
HLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELV
RHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNET
IARRLWDVSCDLLGLPID
NT seq 957 nt   +upstreamnt  +downstreamnt
atggttgagctcatgttcccgctgttgctcctccttctgcccttccttctgtatatggct
gcgccccaaatcaggaaaatgctgtccagtggggtgtgtacatcaactgttcagcttcct
gggaaagtagttgtggtcacaggagctaatacaggtatcgggaaggagacagccaaagag
ctggctcagagaggagctcgagtatatttagcttgccgggatgtggaaaagggggaattg
gtggccaaagagatccagaccacgacagggaaccagcaggtgttggtgcggaaactggac
ctgtctgatactaagtctattcgagcttttgctaagggcttcttagctgaggaaaagcac
ctccacgttttgatcaacaatgcaggagtgatgatgtgtccgtactcgaagacagcagat
ggctttgagatgcacataggagtcaaccacttgggtcacttcctcctaacccatctgctg
ctagagaaactaaaggaatcagccccatcaaggatagtaaatgtgtcttccctcgcacat
cacctgggaaggatccacttccataacctgcagggcgagaaattctacaatgcaggcctg
gcctactgtcacagcaagctagccaacatcctcttcacccaggaactggcccggagacta
aaaggctctggcgttacgacgtattctgtacaccctggcacagtccaatctgaactggtt
cggcactcatctttcatgagatggatgtggtggcttttctcctttttcatcaagactcct
cagcagggagcccagaccagcctgcactgtgccttaacagaaggtcttgagattctaagt
gggaatcatttcagtgactgtcatgtggcatgggtctctgcccaagctcgtaatgagact
atagcaaggcggctgtgggacgtcagttgtgacctgctgggcctcccaatagactaa

KEGG   Homo sapiens (human): 8608
Entry
8608              CDS       T01001                                 

Gene name
RDH16, RODH-4, SDR9C8, hRDH-E
Definition
(RefSeq) retinol dehydrogenase 16
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8608 (RDH16)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     8608 (RDH16)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR NAD_binding_10
Other DBs
NCBI-GeneID: 8608
NCBI-ProteinID: NP_003699
HGNC: 29674
Ensembl: ENSG00000139547
Vega: OTTHUMG00000170895
Pharos: O75452(Tbio)
UniProt: O75452 Q59FX7
LinkDB
Position
12q13.3
AA seq 317 aa
MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAAC
LTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTA
PNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISK
YGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGE
KFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTF
LVDAIMYWVSPSPAKAL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtggctctacctggcggttttcgtgggcctgtactaccttctgcactggtaccgggag
aggcaggtgctgagccacctgagagataagtatgtgttcatcacgggctgtgactctggc
ttcgggaaactgctggccagacagctggatgcacgaggcttgcgggtgctggctgcatgt
ctgacggagaaaggagccgagcagctgaggggccagacttcagacaggctggagacggtg
accctggatgttaccaagacagagagcgttgctgcagccgcccagtgggtgaaggagtgc
gtgagagacaaaggactctggggcctggtgaataatgctggcatctccttgcccacggct
cccaatgagttgctcaccaagcaggacttcgtgaccatactggacgtgaacttgttgggg
gtgattgatgtgactctgagcctgctgcccttagtgaggagggccaggggccgtgtggtc
aacgtctccagtgtcatgggccgggtgtcactttttggtggaggctactgcatctccaag
tatggcgtggaagccttctctgactccctcaggagggaactctcctactttggggtgaag
gtggctatgattgaacctggctatttcaagactgctgtgaccagtaaggagagattctta
aagagcttcctggagatttgggaccggtccagtccagaggtcaaggaggcctatggcgag
aagtttgttgcagactataagaaatcagctgaacaaatggagcagaagtgcacacaggat
ctgtcgttggtgaccaactgcatggagcatgcgctgattgcctgccacccccgtactcgc
tactcagctggctgggatgccaagcttctctacctccccatgagctacatgcccaccttc
ctggtggatgccattatgtactgggtctctccaagcccggccaaggctctatga

DBGET integrated database retrieval system