KEGG   Homo sapiens (human): 1469
Entry
1469              CDS       T01001                                 

Gene name
CST1
Definition
(RefSeq) cystatin SN
  KO
K13897  cystatin-SN
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1469 (CST1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1469 (CST1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1469 (CST1)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1469
NCBI-ProteinID: NP_001889
OMIM: 123855
HGNC: 2473
Ensembl: ENSG00000170373
Vega: OTTHUMG00000032085
Pharos: P01037(Tbio)
UniProt: P01037
LinkDB
Position
20p11.21
AA seq 141 aa
MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATK
DDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
EIYEVPWENRRSLVKSRCQES
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcccagtatctgagtaccctgctgctcctgctggccaccctagctgtggccctggcc
tggagccccaaggaggaggataggataatcccgggtggcatctataacgcagacctcaat
gatgagtgggtacagcgtgcccttcacttcgccatcagcgagtataacaaggccaccaaa
gatgactactacagacgtccgctgcgggtactaagagccaggcaacagaccgttgggggg
gtgaattacttcttcgacgtagaggtgggccgcaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
gagatctacgaagttccctgggagaacagaaggtccctggtgaaatccaggtgtcaagaa
tcctag

KEGG   Homo sapiens (human): 1470
Entry
1470              CDS       T01001                                 

Gene name
CST2
Definition
(RefSeq) cystatin SA
  KO
K13898  cystatin-SA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1470 (CST2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1470 (CST2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1470 (CST2)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1470
NCBI-ProteinID: NP_001313
OMIM: 123856
HGNC: 2474
Ensembl: ENSG00000170369
Vega: OTTHUMG00000032086
Pharos: P09228(Tbio)
UniProt: P09228
LinkDB
Position
20p11.21
AA seq 141 aa
MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATE
DEYYRRLLRVLRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
QIYEVPWEDRMSLVNSRCQEA
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcctggcccctgtgcaccctgctgctcctgctggccacccaggctgtggccctggcc
tggagcccccaggaggaggacaggataatcgagggtggcatctatgatgcagacctcaat
gatgagcgggtacagcgtgcccttcactttgtcatcagcgagtataacaaggccactgaa
gatgagtactacagacgcctgctgcgggtgctacgagccagggagcagatcgtgggcggg
gtgaattacttcttcgacatagaggtgggccgaaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
cagatctacgaagttccctgggaggacagaatgtccctggtgaattccaggtgtcaagaa
gcctag

KEGG   Homo sapiens (human): 1471
Entry
1471              CDS       T01001                                 

Gene name
CST3, ARMD11, HEL-S-2
Definition
(RefSeq) cystatin C
  KO
K13899  cystatin-C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Disease
H00821  Age-related macular degeneration
H01185  Cerebral amyloid angiopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1471 (CST3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1471 (CST3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1471 (CST3)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1471 (CST3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1471 (CST3)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1471
NCBI-ProteinID: NP_000090
OMIM: 604312
HGNC: 2475
Ensembl: ENSG00000101439
Vega: OTTHUMG00000032080
Pharos: P01034(Tbio)
UniProt: P01034 A0A0K0K1J1
LinkDB
Structure
PDB: 

Position
20p11.21
AA seq 146 aa
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggccgggcccctgcgcgccccgctgctcctgctggccatcctggccgtggccctggcc
gtgagccccgcggccggctccagtcccggcaagccgccgcgcctagtgggaggccccatg
gacgccagcgtggaggaggagggtgtgcggcgtgcactggactttgccgtcggcgagtac
aacaaagccagcaacgacatgtaccacagccgcgcgctgcaggtggtgcgcgcccgcaag
cagatcgtagctggggtgaactacttcttggacgtggagctgggccgaaccacgtgtacc
aagacccagcccaacttggacaactgccccttccatgaccagccacatctgaaaaggaaa
gcattctgctctttccagatctacgctgtgccttggcagggcacaatgaccttgtcgaaa
tccacctgtcaggacgcctag

KEGG   Homo sapiens (human): 1472
Entry
1472              CDS       T01001                                 

Gene name
CST4
Definition
(RefSeq) cystatin S
  KO
K13900  cystatin-S
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1472 (CST4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1472 (CST4)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1472 (CST4)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1472
NCBI-ProteinID: NP_001890
OMIM: 123857
HGNC: 2476
Ensembl: ENSG00000101441
Vega: OTTHUMG00000032083
Pharos: P01036(Tbio)
UniProt: P01036
LinkDB
Position
20p11.21
AA seq 141 aa
MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATE
DEYYRRPLQVLRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
EIYEVPWEDRMSLVNSRCQEA
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcccggcctctgtgtaccctgctactcctgatggctaccctggctggggctctggcc
tcgagctccaaggaggagaataggataatcccaggtggcatctatgatgcagacctcaat
gatgagtgggtacagcgtgcccttcacttcgccatcagcgagtacaacaaggccaccgaa
gatgagtactacagacgcccgctgcaggtgctgcgagccagggagcagacctttgggggg
gtgaattacttcttcgacgtagaggtgggccgcaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
gagatctacgaagttccctgggaggacagaatgtccctggtgaattccaggtgtcaagaa
gcctag

KEGG   Homo sapiens (human): 1473
Entry
1473              CDS       T01001                                 

Gene name
CST5
Definition
(RefSeq) cystatin D
  KO
K13901  cystatin-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1473 (CST5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1473 (CST5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1473 (CST5)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1473
NCBI-ProteinID: NP_001891
OMIM: 123858
HGNC: 2477
Ensembl: ENSG00000170367
Vega: OTTHUMG00000032089
Pharos: P28325(Tbio)
UniProt: P28325
LinkDB
Structure
PDB: 
1ROA 1RN7

Position
20p11.21
AA seq 142 aa
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVIN
KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS
FQINEVPWEDKISILNYKCRKV
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatgtggcccatgcacaccccactgctgctgctgactgccttgatggtggccgtggcc
gggagtgcctcggcccaatctaggaccttggcaggtggcatccatgccacagacctcaat
gacaagagtgtgcagtgtgccctggactttgccatcagcgagtacaacaaggtcattaat
aaggatgagtactacagccgccctctgcaggtgatggctgcctaccagcagatcgtgggt
ggggtgaactactacttcaatgtgaagttcggtcgaaccacatgcaccaagtcccagccc
aacttggacaactgtcccttcaatgaccagccaaaactgaaagaggaagagttctgctct
ttccagatcaatgaagttccctgggaggataaaatttccattctgaactacaagtgccgg
aaagtctag

DBGET integrated database retrieval system