KEGG   Homo sapiens (human): 1471
Entry
1471              CDS       T01001                                 

Gene name
CST3, ARMD11, HEL-S-2
Definition
(RefSeq) cystatin C
  KO
K13899  cystatin-C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Disease
H00821  Age-related macular degeneration
H01185  Cerebral amyloid angiopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    1471 (CST3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1471 (CST3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1471 (CST3)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   1471 (CST3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1471 (CST3)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 1471
NCBI-ProteinID: NP_000090
OMIM: 604312
HGNC: 2475
Ensembl: ENSG00000101439
Vega: OTTHUMG00000032080
Pharos: P01034(Tbio)
UniProt: P01034 A0A0K0K1J1
LinkDB
Structure
PDB: 

Position
20p11.21
AA seq 146 aa
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggccgggcccctgcgcgccccgctgctcctgctggccatcctggccgtggccctggcc
gtgagccccgcggccggctccagtcccggcaagccgccgcgcctagtgggaggccccatg
gacgccagcgtggaggaggagggtgtgcggcgtgcactggactttgccgtcggcgagtac
aacaaagccagcaacgacatgtaccacagccgcgcgctgcaggtggtgcgcgcccgcaag
cagatcgtagctggggtgaactacttcttggacgtggagctgggccgaaccacgtgtacc
aagacccagcccaacttggacaactgccccttccatgaccagccacatctgaaaaggaaa
gcattctgctctttccagatctacgctgtgccttggcagggcacaatgaccttgtcgaaa
tccacctgtcaggacgcctag

DBGET integrated database retrieval system