KEGG   Homo sapiens (human): 147111Help
Entry
147111            CDS       T01001                                 

Gene name
NOTUM, hNOTUM
Definition
(RefSeq) notum, palmitoleoyl-protein carboxylesterase
  KO
K19882  O-palmitoleoyl-L-serine hydrolase [EC:3.1.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    147111 (NOTUM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.98  [Wnt protein] O-palmitoleoyl-L-serine hydrolase
     147111 (NOTUM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAE DUF5535
Motif
Other DBs
NCBI-GeneID: 147111
NCBI-ProteinID: NP_848588
OMIM: 609847
HGNC: 27106
Ensembl: ENSG00000185269
Vega: OTTHUMG00000154416
Pharos: Q6P988(Tbio)
UniProt: Q6P988
LinkDB All DBs
Structure
PDB: 

Position
17q25.3
AA seq 496 aa AA seqDB search
MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVE
GNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRW
LLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFI
PYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLL
NVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNG
VVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGL
RLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQP
QGLEPSELLGMLSNGS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggccgaggggtgcgcgtgctgctgctgctgagcctgctgcactgcgccgggggcagc
gagggcaggaagacctggcggcgccggggtcagcagccgcctcctcccccgcggaccgag
gcggcgccggcggccggacagcccgtggagagcttcccgctggacttcacggccgtggag
ggtaacatggacagcttcatggcgcaagtcaagagcctggcgcagtccctgtacccctgc
tccgcgcagcagctcaacgaggacctgcgcctgcacctcctactcaacacctcggtgacc
tgcaacgacggcagccccgccggctactacctgaaggagtccaggggcagccggcggtgg
ctcctcttcctggaaggcggctggtactgcttcaaccgcgagaactgcgactccagatac
gacaccatgcggcgcctcatgagctcccgggactggccgcgcactcgcacaggcacaggg
atcctgtcctcacagccggaggagaacccctactggtggaacgcaaacatggtcttcatc
ccctactgctccagtgatgtttggagcggggcttcatccaagtctgagaagaacgagtac
gccttcatgggcgccctcatcatccaggaggtggtgcgggagcttctgggcagagggctg
agcggggccaaggtgctgctgctggccgggagcagcgcggggggcaccggggtgctcctg
aatgtggaccgtgtggctgagcagctggagaagctgggctacccagccatccaggtgcga
ggcctggctgactccggctggttcctggacaacaagcagtatcgccacacagactgcgtc
gacacgatcacgtgcgcgcccacggaggccatccgccgtggcatcaggtactggaacggg
gtggtcccggagcgctgccgacgccagttccaggagggcgaggagtggaactgcttcttt
ggctacaaggtctacccgaccctgcgctgccctgtgttcgtggtgcagtggctgtttgac
gaggcacagctgacggtggacaacgtgcacctgacggggcagccggtgcaggagggcctg
cggctgtacatccagaacctcggccgcgagctgcgccacacactcaaggacgtgccggcc
agctttgcccccgcctgcctctcccatgagatcatcatccggagccactggacggatgtc
caggtgaaggggacgtcgctgccccgagcactgcactgctgggacaggagcctccatgac
agccacaaggccagcaagacccccctcaagggctgccccgtccacctggtggacagctgc
ccctggccccactgcaacccctcatgccccaccgtccgagaccagttcacggggcaagag
atgaacgtggcccagttcctcatgcacatgggcttcgacatgcagacggtggcccagccg
cagggactggagcccagtgagctgctggggatgctgagcaacggaagctag

DBGET integrated database retrieval system