KEGG   Homo sapiens (human): 1490
Entry
1490              CDS       T01001                                 

Gene name
CCN2, CTGF, HCS24, IGFBP8, NOV2
Definition
(RefSeq) cellular communication network factor 2
  KO
K06827  connective tissue growth factor (insulin-like growth factor-binding protein 8)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
Drug target
Pamrevlumab: D10969
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1490 (CCN2)
   04371 Apelin signaling pathway
    1490 (CCN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1490 (CCN2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    1490 (CCN2)
SSDB
Motif
Pfam: TSP1_CCN Cys_knot VWC IGFBP TSP_1
Other DBs
NCBI-GeneID: 1490
NCBI-ProteinID: NP_001892
OMIM: 121009
HGNC: 2500
Ensembl: ENSG00000118523
Vega: OTTHUMG00000015573
Pharos: P29279(Tbio)
UniProt: Q5M8T4
LinkDB
Position
6q23.2
AA seq 349 aa
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaccgccgccagtatgggccccgtccgcgtcgccttcgtggtcctcctcgccctctgc
agccggccggccgtcggccagaactgcagcgggccgtgccggtgcccggacgagccggcg
ccgcgctgcccggcgggcgtgagcctcgtgctggacggctgcggctgctgccgcgtctgc
gccaagcagctgggcgagctgtgcaccgagcgcgacccatgcgacccgcacaagggccta
ttctgtcacttcggctccccggccaaccgcaagatcggcgtgtgcaccgccaaagatggt
gctccctgcatcttcggtggtacggtgtaccgcagcggagagtccttccagagcagctgc
aagtaccagtgcacgtgcctggacggggcggtgggctgcatgcccctgtgcagcatggac
gttcgtctgcccagccctgactgccccttcccgaggagggtcaagctgcccgggaaatgc
tgcgaggagtgggtgtgtgacgagcccaaggaccaaaccgtggttgggcctgccctcgcg
gcttaccgactggaagacacgtttggcccagacccaactatgattagagccaactgcctg
gtccagaccacagagtggagcgcctgttccaagacctgtgggatgggcatctccacccgg
gttaccaatgacaacgcctcctgcaggctagagaagcagagccgcctgtgcatggtcagg
ccttgcgaagctgacctggaagagaacattaagaagggcaaaaagtgcatccgtactccc
aaaatctccaagcctatcaagtttgagctttctggctgcaccagcatgaagacataccga
gctaaattctgtggagtatgtaccgacggccgatgctgcaccccccacagaaccaccacc
ctgccggtggagttcaagtgccctgacggcgaggtcatgaagaagaacatgatgttcatc
aagacctgtgcctgccattacaactgtcccggagacaatgacatctttgaatcgctgtac
tacaggaagatgtacggagacatggcatga

DBGET integrated database retrieval system