KEGG   Homo sapiens (human): 149461
Entry
149461            CDS       T01001                                 

Gene name
CLDN19, HOMG5
Definition
(RefSeq) claudin 19
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    149461 (CLDN19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    149461 (CLDN19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    149461 (CLDN19)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    149461 (CLDN19)
  09172 Infectious disease: viral
   05160 Hepatitis C
    149461 (CLDN19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    149461 (CLDN19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   149461 (CLDN19)
  Exosomal proteins of colorectal cancer cells
   149461 (CLDN19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Mntp SUR7
Other DBs
NCBI-GeneID: 149461
NCBI-ProteinID: NP_683763
OMIM: 610036
HGNC: 2040
Ensembl: ENSG00000164007
Vega: OTTHUMG00000007524
Pharos: Q8N6F1(Tbio)
UniProt: Q8N6F1
LinkDB
Position
1p34.2
AA seq 224 aa
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI
AGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGS
FLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccaactcaggcctccagctcctgggctacttcttggccctgggtggctgggtgggc
atcattgctagcacagccctgccacagtggaagcagtcttcctacgcaggcgacgccatc
atcactgccgtgggcctctatgaagggctctggatgtcctgcgcctcccagagcactggg
caagtgcagtgcaagctctacgactcgctgctcgccctggacggtcacatccaatcagcg
cgggccctgatggtggtggccgtgctcctgggcttcgtggccatggtcctcagcgtagtt
ggcatgaagtgtacgcgggtgggagacagcaaccccattgccaagggccgtgttgccatc
gccgggggagccctcttcatcctggcaggcctctgcactttgactgctgtctcgtggtat
gccaccctggtgacccaggagttcttcaacccaagcacacctgtcaatgccaggtatgaa
tttggcccagccctgttcgtgggctgggcctcagctggcctggccgtgctgggcggctcc
ttcctctgctgcacatgcccggagccagagagacccaacagcagcccacagccctatcgg
cctggaccctctgctgctgcccgagaaccagttgttaaattgcccgcctccgccaagggc
cccctgggtgtgtaa

DBGET integrated database retrieval system