KEGG   Homo sapiens (human): 150946
Entry
150946            CDS       T01001                                 

Gene name
GAREM2, FAM59B, GAREML
Definition
(RefSeq) GRB2 associated regulator of MAPK1 subtype 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CABIT SAM_1
Other DBs
NCBI-GeneID: 150946
NCBI-ProteinID: NP_001161713
OMIM: 617999
HGNC: 27172
Ensembl: ENSG00000157833
Vega: OTTHUMG00000151935
Pharos: Q75VX8(Tdark)
UniProt: Q75VX8
LinkDB
Position
2p23.3
AA seq 874 aa
MEKLAAGLAGLRWSMGAFPLDLIVSRCRLPTLACLGPGEYAEGVSERDILLIHSCRQWTT
VTAHTLEEGHYVIGPKIDIPLQYPGKFKLLEQARDVREPVRYFSSVEEVASVFPDRIFVM
EAITFSVKVVSGEFSEDSEVYNFTLHAGDELTLMGQAEILCAKTTKERSRFTTLLRKLGR
AGALAGVGGGGPASAGAAGGTGGGGARPVKGKMPCLICMNHRTNESLSLPFQCQGRFSTR
SPLELQMQEGEHTVRAIIERVRLPVNVLVPSRPPRNPYDLHPVREGHCYKLVSIISKTVV
LGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEYSTA
VREAPAELAEDCASPRRARLCLPAPRAPGLARAPGPLAPAPAGEGDQEYVSPDWAAAPEP
AAPPAEIPYEELWAHQGPEGLVRPPPGLDLISFGAAGPPRREPEAPPPPVPPKSEAVKEE
CRLLNAPPVPPRGGNGSGRLSSSPPVPPRFPKLQPVHSPSSSLSYYSSGLQDGAGSRSGS
GSPSPDTYSLYCYPCTWGDCKVGESSSRPAPGPLPSTTQPSQASRALTEPLSGRAASLLG
ADTPVKTYHSCPPLFKPSHPQKRFAPFGALNPFSGPAYPSGPSAALSSGPRTTSGPVATS
GPAYSPGPASPGQAYSAAPPSSCAPSSSSSSEWQEPVLEPFDPFELGQGSSPEPELLRSQ
EPRAVGTPGPGPRLSPLGPSKAFEPEGLVLHQVPTPLSPAALQGPEAGGALFLTQGRLEG
PPASPRDGATGFGVRDASSWQPPADLSALSLEEVSRSLRFIGLSEDVVSFFARERIDGSI
FVQLSEDILADDFHLTKLQVKKIMQFIKGWRPKI
NT seq 2625 nt   +upstreamnt  +downstreamnt
atggagaagctggcggccgggctggccggcctgcgctggagcatgggcgccttcccgctc
gacctcatcgtcagccgctgccgcctgcccacgctcgcctgccttgggccaggggagtac
gccgagggcgtcagtgagcgagacatcctgctcatccactcctgccggcagtggacaacg
gtgacagctcataccctggaggagggccactatgtcatcgggcccaagatcgacatcccc
ctgcagtacccagggaagttcaagctcctggaacaggcccgggatgtgcgggagccagtg
aggtacttcagcagcgtggaggaggtggccagtgtcttccctgaccgcatcttcgtgatg
gaagccatcaccttcagcgtcaaggtggtgtcgggcgagttcagcgaggacagcgaggtg
tacaacttcacgctgcatgcgggcgacgagctcactcttatgggccaggcggagatcctg
tgcgccaagaccaccaaggagcgctcgcgcttcaccaccctcctgcgaaagctgggccgg
gccggggcgctggccggggtgggcggcggcggcccagcgagcgcgggggccgcgggaggc
actggcggcgggggcgccaggccggtcaaaggcaagatgccctgcctcatctgcatgaac
caccgcaccaacgaaagcctgagcctgccctttcagtgccagggccgcttcagcactcgc
agcccgctggagctgcagatgcaagagggcgagcacacggtgcgcgccatcatcgagcgc
gtgaggctgccggtgaacgtgctggtgcccagccggccgccgcgcaacccctacgacctg
cacccggtgcgggagggtcattgctacaagctggttagcatcatctccaagacggtggtg
ctggggctggcgctgcgccgcgagggcccggcgccgctgcacttcctgctgctcacggac
acgccgcgcttcgcgctgccgcagggcctgctggccggggacccgcgcgtcgagcgcctg
gtgcgcgacagcgcctcctactgccgcgagcgcttcgaccccgacgagtactccacggcc
gtgcgcgaggcgccagcggagctcgccgaagactgcgccagcccgcgccgcgcgcgcctc
tgcctgcccgcgccgcgcgcccccgggctcgcccgcgcccccggcccgctagcgccggct
cccgccggcgagggcgaccaggagtacgtgagccccgactgggcagccgcgcccgagccc
gccgcgccgcccgccgagatcccctacgaggagttgtgggcgcaccaggggcccgagggc
ctcgtccggccgcccccagggctcgatctcatctccttcggggccgcgggaccgccgcgt
cgggagccggaagcgccgccgcctccagtccctcccaaatccgaggcggtgaaggaggag
tgccgcctgctcaatgcccctccagtgcctccccggggtggcaatggcagcggccggctc
tccagcagccccccggttccccctcgcttccccaagctgcagccggtacattcccccagc
tccagcctctcctactactcctctggcctccaggatggggcgggttcccgcagtggcagt
ggctccccatcgccggacacctactccctctattgctacccatgcacctggggagactgc
aaggtgggcgagtcctctagccgcccagcccccggtcccctaccctcaaccacacagccc
agccaggcctcccgggccctcacagagcctctgagcggtcgagccgcctcccttctgggg
gctgacacccctgttaagacctaccacagctgccctcctctattcaagccctcacatccc
cagaagcgctttgctccgtttggagctctcaaccctttttccgggcctgcctacccctca
ggcccttcagcggccttgtcttctgggcccagaaccacctcgggtcctgtggctacctct
ggccctgcgtattccccaggcccagcctcgccaggccaggcctattcagctgctcccccc
tcctcctgcgccccctcctcctcctcttcttctgaatggcaggaaccagtcctggagccc
ttcgatccctttgagctggggcagggcagttctccagagcctgagctgctgcgttctcag
gagcccagagcagtggggacacctgggcctggaccccgcctttcaccacttggcccctcc
aaggcctttgagcctgaaggtttggtgctgcaccaggtccccaccccactgtcaccagct
gctctgcagggacccgaggcgggaggagcactttttctaacccaagggcgcctggaaggg
cctcctgccagtccccgggatggagccacaggctttggagtccgagatgcctcctcctgg
cagccccctgctgacctgtctgcactctccctggaggaggtctctcgcagtctgcgtttc
atcgggctctcagaggatgtggtgagcttctttgcccgagaacgcatcgatggtagcatc
tttgtgcagctcagtgaggacatcctggcagatgacttccacctcaccaagctgcaggtc
aagaagatcatgcagttcatcaaaggctggaggcccaagatctga

DBGET integrated database retrieval system