KEGG   Homo sapiens (human): 1524Help
Entry
1524              CDS       T01001                                 

Gene name
CX3CR1, CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28
Definition
(RefSeq) C-X3-C motif chemokine receptor 1
  KO
K04192  CX3C chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
Disease
H00821  Age-related macular degeneration
H01742  Coronary artery disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1524 (CX3CR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1524 (CX3CR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1524 (CX3CR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1524 (CX3CR1)
   04050 Cytokine receptors [BR:hsa04050]
    1524 (CX3CR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CX3C Chemokine
    1524 (CX3CR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CX3C Chemokine
   1524 (CX3CR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 1524
NCBI-ProteinID: NP_001164642
OMIM: 601470
HGNC: 2558
Ensembl: ENSG00000168329
Vega: OTTHUMG00000156249
Pharos: P49238(Tchem)
UniProt: P49238
LinkDB All DBs
Position
3p22.2
AA seq 355 aa AA seqDB search
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatcagttccctgaatcagtgacagaaaactttgagtacgatgatttggctgaggcc
tgttatattggggacatcgtggtctttgggactgtgttcctgtccatattctactccgtc
atctttgccattggcctggtgggaaatttgttggtagtgtttgccctcaccaacagcaag
aagcccaagagtgtcaccgacatttacctcctgaacctggccttgtctgatctgctgttt
gtagccactttgcccttctggactcactatttgataaatgaaaagggcctccacaatgcc
atgtgcaaattcactaccgccttcttcttcatcggcttttttggaagcatattcttcatc
accgtcatcagcattgataggtacctggccatcgtcctggccgccaactccatgaacaac
cggaccgtgcagcatggcgtcaccatcagcctaggcgtctgggcagcagccattttggtg
gcagcaccccagttcatgttcacaaagcagaaagaaaatgaatgccttggtgactacccc
gaggtcctccaggaaatctggcccgtgctccgcaatgtggaaacaaattttcttggcttc
ctactccccctgctcattatgagttattgctacttcagaatcatccagacgctgttttcc
tgcaagaaccacaagaaagccaaagccattaaactgatccttctggtggtcatcgtgttt
ttcctcttctggacaccctacaacgttatgattttcctggagacgcttaagctctatgac
ttctttcccagttgtgacatgaggaaggatctgaggctggccctcagtgtgactgagacg
gttgcatttagccattgttgcctgaatcctctcatctatgcatttgctggggagaagttc
agaagatacctttaccacctgtatgggaaatgcctggctgtcctgtgtgggcgctcagtc
cacgttgatttctcctcatctgaatcacaaaggagcaggcatggaagtgttctgagcagc
aattttacttaccacacgagtgatggagatgcattgctccttctctga

DBGET integrated database retrieval system