KEGG   Homo sapiens (human): 153090Help
Entry
153090            CDS       T01001                                 

Gene name
DAB2IP, AF9Q34, AIP-1, AIP1, DIP1/2
Definition
(RefSeq) DAB2 interacting protein
  KO
K19901  disabled homolog 2-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    153090 (DAB2IP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    153090 (DAB2IP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3498 RasGAP C2 Bacillus_HBL PH PH_2
Motif
Other DBs
NCBI-GeneID: 153090
NCBI-ProteinID: NP_115941
OMIM: 609205
HGNC: 17294
Ensembl: ENSG00000136848
Vega: OTTHUMG00000020595
Pharos: Q5VWQ8(Tbio)
UniProt: Q5VWQ8
LinkDB All DBs
Position
9q33.2
AA seq 1132 aa AA seqDB search
MEPDSLLDQDDSYESPQERPGSRRSLPGSLSEKSPSMEPSAATPFRVTGFLSRRLKGSIK
RTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALD
LSMEEEVVIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNS
RRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPL
RTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMI
RIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGK
VKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYES
DENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRG
RPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQNLANFAKFG
SKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAV
SQLEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIE
NDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGGKSLSM
VDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPT
TPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAA
AAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNSAGPQRRIDQPPPPPPPPP
PAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPELKPRAVHK
QGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDK
LRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISRLMS
VEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKESMH
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgactcccttctggaccaagacgactcctacgagtcgcctcaagaaaggccg
ggctctcggcgcagcctgcctggcagcctttccgagaagagccccagcatggagccctcg
gccgccacgccgttccgggtcacgggcttcctcagccgccgcctcaagggctccatcaag
cgcaccaagagccagcccaagctggaccgcaaccacagcttccgccacatcctgccgggg
ttccggagcgccgccgccgccgccgcggacaatgagaggtcccatctgatgccgaggctg
aaggagtctcgctcccacgagtccctgctcagccccagcagtgcggtggaggcgctggac
ctcagcatggaggaagaggtggtcatcaagcccgtgcacagcagcatccttggccaggac
tactgcttcgaggtgacgacgtcatcaggaagcaagtgcttttcctgccggtctgcagct
gagcgggataagtggatggagaacctccggcgagcggtgcatcccaacaaggacaacagc
cggcgtgtggagcacatcctgaagctgtgggtgatcgaggccaaggacctgccagccaag
aagaagtacctgtgcgagctgtgcctggacgatgtgctctatgcccgcaccacgggcaag
ctcaagacggacaatgttttctggggcgagcacttcgagttccacaacttgccgcctctg
cgcacggtcactgtccacctgtaccgggagaccgacaagaagaagaagaaggagcgcaac
agttacctgggcctggtgagcctacctgctgcctcggtggccgggcggcagttcgtggag
aagtggtacccggtggtgacgcccaaccccaagggcggcaagggccctggacccatgatc
cgcatcaaggcgcgctaccaaaccatcaccatcctgcccatggagatgtacaaagagttc
gctgagcacatcaccaaccactacctggggctgtgtgcagccctcgagcccatcctcagt
gccaagaccaaggaggagatggcatctgccctggtgcacatcctgcagagcacgggcaag
gtgaaggacttcctgacagacctgatgatgtcagaggtggaccgctgcggggacaacgag
cacctcatcttccgggagaacacactggccaccaaggccattgaggagtacctcaagcta
gtgggccagaagtacctgcaggacgccctaggtgagttcatcaaagcgctgtatgagtca
gatgagaactgcgaagtggatcccagcaagtgctcggccgctgacctcccagagcaccag
ggcaacctcaagatgtgctgcgagctggccttctgcaagatcatcaactcctactgtgtc
ttcccacgggagttgaaagaggtgtttgcctcgtggaggcaggagtgcagcagtcgcggc
cgcccggacatcagtgagcggctcatcagcgcctccctcttcctgcgcttcctctgccca
gccatcatgtcgccctcactcttcaacctgctgcaggagtaccctgatgaccgcactgcc
cgcaccctcaccctcatcgccaaggtcacccagaacctggccaactttgccaaatttggc
agcaaggaggaatacatgtccttcatgaaccagttcctagagcatgagtggaccaacatg
cagcgcttcctgctggagatctccaaccccgagaccctctccaatacagccggcttcgag
ggctacatcgacctgggccgcgagctctccagcctgcactcactgctctgggaggccgtc
agccagctggagcagagcatagtatccaaactgggacccctgcctcggatcctgagggac
gtccacacagcactgagcaccccaggtagcgggcagctcccagggaccaatgacctggcc
tccacaccgggctctggcagcagcagcatctcagctgggctgcagaagatggtgattgag
aacgatctttccggtctgatagatttcacccggttaccgtctccaacccccgaaaacaag
gacttgttttttgtcacaaggtcctccggggtccagccctcacctgcccgcagctcgagt
tactcggaagccaacgagcctgatcttcagatggccaacggtggcaagagcctctccatg
gtggacctccaggacgcccgcacgctggatggggaggcaggctccccggcgggccccgac
gtcctccccacagatgggcaggccgctgcagctcagctggtggccgggtggccggcccgg
gcaaccccagtgaacctggcagggctggccacggtgcggcgggcaggccagacaccaacc
acaccaggcacctccgagggcgcgccaggccggccccagctgttggcaccgctctccttc
cagaaccctgtgtaccagatggcggctggcctgccgctgtcaccccgtggccttggcgac
tcaggctctgagggccacagctccctgagctcacacagcaacagcgaggagttggcggct
gctgccaagctgggaagtttcagcactgccgcggaggagctggctcggcggcccggtgag
ctggcacggcgacagatgtcactgactgaaaaaggcgggcagcccacggtgccacggcag
aacagtgctggcccccagaggaggatcgaccagcctccgcccccacccccgccgccacct
cctgccccccgcggccggacgccccccaacctgctgagcaccctgcagtacccaagaccc
tcaagcggaaccctggcgtcggcctcacctgattgggtgggccccagtacccgcctgagg
cagcagtcctcttcctccaagggggacagcccagaactgaagccacgggcagtgcacaag
cagggcccttcacctgtgagccccaatgccctggaccgcacagccgcttggctcttgacc
atgaacgcgcagttgttagaagacgagggcctgggcccagaccccccccacagggatagg
ctaaggagtaaggacgagctcagccaagcagaaaaggacctggcggtgctgcaggacaag
ctgcgaatctccaccaagaagctggaggagtatgagaccctgttcaagtgccaggaggag
acgacgcagaagctggtgctggagtaccaggcacggctggaggagggcgaggagcggctg
cggcggcagcaggaggacaaggacatccagatgaagggcatcatcagcaggttgatgtcc
gtggaggaagaactgaagaaggaccacgcagagatgcaagcggctgtggactccaaacag
aagatcattgatgcccaggagaagcgcattgcctcgttggatgccgccaatgcccgcctc
atgagtgccctgacccagctgaaagagagtatgcattag

DBGET integrated database retrieval system