KEGG   Homo sapiens (human): 1535
Entry
1535              CDS       T01001                                 

Gene name
CYBA, CGD4, p22-PHOX
Definition
(RefSeq) cytochrome b-245 alpha chain
  KO
K08009  cytochrome b-245, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa05020  Prion disease
hsa05140  Leishmaniasis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06415  PI3K signaling
nt06465  Prion disease
  Element
N01204  PRNP-PI3K-NOX2 signaling pathway
N01205  Scrapie conformation PrPSc to PRNP-PI3K-NOX2 signaling pathway
Disease
H00098  Chronic granulomatous disease
H01167  Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1535 (CYBA)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1535 (CYBA)
   04670 Leukocyte transendothelial migration
    1535 (CYBA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1535 (CYBA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    1535 (CYBA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    1535 (CYBA)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    1535 (CYBA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1535 (CYBA)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    1535 (CYBA)
SSDB
Motif
Pfam: Cytochrom_B558a Cg6151-P DUF308
Other DBs
NCBI-GeneID: 1535
NCBI-ProteinID: NP_000092
OMIM: 608508
HGNC: 2577
Ensembl: ENSG00000051523
Vega: OTTHUMG00000173320
Pharos: P13498(Tbio)
UniProt: P13498 B4DT46
LinkDB
Structure
PDB: 
1WLP

Position
16q24.2
AA seq 195 aa
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP
GGPQVNPIPVTDEVV
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcgtccggcctgatc
ctcatcaccgggggcatcgtggccacagctgggcgcttcacccagtggtactttggtgcc
tactccattgtggcgggcgtgtttgtgtgcctgctggagtacccccgggggaagaggaag
aagggctccaccatggagcgctggggacagaagtacatgaccgccgtggtgaagctgttc
gggccctttaccaggaattactatgttcgggccgtcctgcatctcctgctctcggtgccc
gccggcttcctgctggccaccatccttgggaccgcctgcctggccattgcgagcggcatc
tacctactggcggctgtgcgtggcgagcagtggacgcccatcgagcccaagccccgggag
cggccgcagatcggaggcaccatcaagcagccgcccagcaaccccccgccgcggcccccg
gccgaggcccgcaagaagcccagcgaggaggaggctgcggtggcggcggggggacccccg
ggaggtccccaggtcaaccccatcccggtgaccgacgaggtcgtgtga

DBGET integrated database retrieval system