KEGG   Homo sapiens (human): 1537Help
Entry
1537              CDS       T01001                                 

Gene name
CYC1, MC3DN6, UQCR4
Definition
(RefSeq) cytochrome c1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1537 (CYC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1537 (CYC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1537 (CYC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1537 (CYC1)
   05012 Parkinson disease
    1537 (CYC1)
   05016 Huntington disease
    1537 (CYC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1537 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-GeneID: 1537
NCBI-ProteinID: NP_001907
OMIM: 123980
HGNC: 2579
Ensembl: ENSG00000179091
Vega: OTTHUMG00000165242
Pharos: P08574(Tbio)
UniProt: P08574
LinkDB All DBs
Structure
PDB: 

Position
8q24.3
AA seq 325 aa AA seqDB search
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctgcggcttcgcttcgcggggtagtgttgggcccgcggggcgcggggctc
ccgggcgcgcgtgcccggggtctgctgtgcagcgcgcgtcccgggcagctcccgctacgg
acacctcaggcagtggccttgtcgtcgaagtctggcctttcccgaggccggaaagtgatg
ctgtcagcgctgggcatgctggcggcagggggtgcggggctggccatggctctgcattcg
gctgtgagtgccagtgacctggagctgcacccccccagctatccgtggtctcaccgtggc
ctcctctcttccttggaccacaccagcatccggaggggtttccaggtatataagcaggtg
tgcgcctcctgccacagcatggacttcgtggcctaccgccacctggtgggcgtgtgctac
acggaggatgaagctaaggagctggctgcggaggtggaggttcaagacggccccaatgaa
gatggggagatgttcatgcggccagggaagctgttcgactatttcccaaaaccatacccc
aacagtgaggctgctcgagctgccaacaacggagcattgccccctgacctcagctacatc
gtgcgagctaggcatggtggtgaggactacgtcttctccctgctcacgggctactgcgag
ccacccaccggggtgtcactgcgggaaggtctctacttcaacccctactttcctggccag
gccattgccatggcccctcccatctacacagatgtcttagagtttgacgatggcacccca
gctaccatgtcccagatagccaaggatgtgtgcaccttcctgcgctgggcatctgagcca
gagcacgaccatcgaaaacgcatggggctcaagatgttgatgatgatggctctgctggtg
cccctggtctacaccataaagcggcacaagtggtcagtcctgaagagtcggaagctggca
tatcggccgcccaagtga

DBGET integrated database retrieval system