KEGG   Homo sapiens (human): 154796
Entry
154796            CDS       T01001                                 

Gene name
AMOT
Definition
(RefSeq) angiomotin
  KO
K16819  angiomotin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    154796 (AMOT)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    154796 (AMOT)
SSDB
Motif
Pfam: Angiomotin_C
Other DBs
NCBI-GeneID: 154796
NCBI-ProteinID: NP_001106962
OMIM: 300410
HGNC: 17810
Ensembl: ENSG00000126016
Vega: OTTHUMG00000022216
Pharos: Q4VCS5(Tbio)
UniProt: Q4VCS5
LinkDB
Structure
PDB: 
6JJX

Position
Xq23
AA seq 1084 aa
MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSD
VLSPQDHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFR
GQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQ
MSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPP
EYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPL
SARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQ
AHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASY
QPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLV
KSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQL
FAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYV
DKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAAL
MELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYD
TALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLS
CMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPST
PSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATA
ATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVA
PSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTP
AVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMV
EYLI
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgagaaattctgaagaacagccaagtggagggaccacggtattgcagcgtttgctacaa
gagcagcttcgctatggcaatcctagtgagaatcgcagcctgcttgccatacaccagcaa
gccacagggaatggccctcctttccccagtggcagtgggaacccgggccctcagagtgat
gtgttgagtccccaagaccaccaccaacagcttgtggctcatgctgctcgacaagaaccc
caggggcaggaaatccagtcagaaaacctcatcatggagaagcagctgtctcctcgaatg
caaaataatgaagaactcccgacctatgaagaagccaaggtccagtcccagtactttcgg
ggccaacagcatgccagtgttggagctgccttctatgtcactggagtcaccaaccagaag
atgaggactgagggacgcccatcagttcagcggctcaatcctggaaagatgcaccaagat
gagggactcagagaccttaagcaagggcatgtccgttccttgagtgaacgactaatgcag
atgtcactggccaccagtggagttaaggcccatccacctgttaccagtgctcccctctcc
ccaccacaacccaatgacctctacaagaatcccacaagttccagtgaattctacaaggcc
caagggccacttcctaaccagcatagcctgaagggcatggaacaccgaggccccccacca
gaatatcccttcaagggcatgccaccccaatctgtagtgtgcaagccccaagagccaggg
cacttctatagtgagcatcgcctgaaccagccagggagaacagaggggcaactgatgagg
tatcagcatccccctgagtatggagcagccaggccagcgcaggacatctcattgccattg
tcagccaggaactcgcagcctcacagccctacttcttctctgacctctggggggtccttg
cccttgctacaatctccaccatccactagattgtctcctgcccgacaccccttggtccca
aaccagggagaccattcagctcacctgcctaggccgcagcagcatttccttcctaatcag
gctcaccagggggatcattaccgtctctcccaacctggcctgagtcagcagcagcagcaa
cagcagcagcagcaccatcatcaccatcaccaccaacaacagcagcagcagcagccacag
cagcagccaggagaagcctattcagctatgcctcgggctcagccatcctctgcttcttat
cagccagtgccagcagacccttttgccattgtttccagagcccagcagatggttgagatc
ctctcagacgagaaccggaacttgaggcaagagttggaaggatgctatgagaaggtggca
agactgcagaaggtggagacagaaatccagcgcgtctcggaggcatatgagaacctcgtg
aagtcatcctccaaaagagaggccctagagaaagccatgagaaacaagctagagggcgag
attcggaggatgcatgatttcaacagggatctgagagagcgtctagagactgccaacaag
cagcttgcagagaaggaatatgaggggtcagaggacaccagaaaaaccatctcgcagctc
tttgcaaaaaataaagaaagccagcgtgagaaggagaagctggaagcggagctggccact
gcccgttctaccaatgaggaccaaagacgacacatcgaaatccgagatcaggccctgagt
aatgcccaggccaaggtggtaaagctggaagaagagctgaaaaagaagcaagtgtacgtt
gacaaggtggagaagatgcagcaggcccttgtacagctccaggcagcatgtgaaaaacgt
gagcagctagagcaccgtctccggacacgactggagagggaactggaatccctgagaatc
cagcagcgtcagggcaactgtcagcccaccaacgtttcagaatacaatgctgctgcactg
atggagctccttcgggagaaagaggagaggattctggctctggaagctgatatgacaaag
tgggagcagaaatatttggaggagaatgtgatgagacattttgctctggatgctgctgca
actgtggctgctcagagggacacaacagtcatcagtcactctcctaacaccagctatgac
acagctctagaagctcgcatccagaaagaggaggaagaaatcttgatggccaataagcgt
tgccttgacatggagggcaggattaagaccctccatgcccagattattgagaaggatgcc
atgatcaaagtactccagcagcgttcccggaaggagccgagcaagacagagcagctgtcg
tgcatgcggccagcgaagtctctgatgtccatttccaatgctggatcaggcttgctctcc
cactcatccaccctgactggctcccccatcatggaagaaaagcgagacgacaagagctgg
aaggggagcctaggcattctcctgggtggagactaccgtgctgaatatgtcccttccaca
ccctcgcctgtgccaccctcgactcccctgctctcggctcactccaagacaggcagccga
gactgcagtacccaaactgaacgtgggacggaatcgaacaaaactgcagctgttgctccc
atctctgttcctgctccagttgctgctgccgccactgctgccgccatcactgccactgct
gccaccatcaccaccaccatggtagctgctgctccagttgctgttgctgctgctgctgct
ccagctgctgctgctgccccgtctccagccactgccgctgctactgctgctgctgtttct
ccagctgctgctggtcagattccagctgctgcctctgttgcctcagctgctgccgttgct
ccttctgctgctgctgctgctgctgttcaggttgctccagctgctccggctccagttcca
gctccggctctggttccggttccagctccagcagcggctcaggcttctgctcctgctcag
actcaggcaccaacttcagctccggctgtggctccaactccagctccaactccaactcca
gctgtggctcaggctgaggttcctgcaagtccagctaccggtcctggaccacatcgtttg
tctataccaagtttgacctgcaatccagacaaaacagatgggcctgtgttccactccaat
actctggaaagaaaaactcccattcagatcctgggacaagagcctgatgcagagatggtg
gaatatctcatctaa

KEGG   Homo sapiens (human): 154810
Entry
154810            CDS       T01001                                 

Gene name
AMOTL1, JEAP
Definition
(RefSeq) angiomotin like 1
  KO
K06104  angiomotin like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    154810 (AMOTL1)
SSDB
Motif
Pfam: Angiomotin_C NPV_P10 APC_N_CC
Other DBs
NCBI-GeneID: 154810
NCBI-ProteinID: NP_570899
OMIM: 614657
HGNC: 17811
Ensembl: ENSG00000166025
Vega: OTTHUMG00000167828
Pharos: Q8IY63(Tbio)
UniProt: Q8IY63 A0A024R3A6
LinkDB
Position
11q21
AA seq 956 aa
MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATS
SIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLA
IQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQ
PQQNNEELPTYEEAKAQSQFFRGQQQQQQQQGAVGHGYYMAGGTSQKSRTEGRPTVNRAN
SGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLPGSGNGKGFKVGGGPSPAQPA
GKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYPAPQPVRTDVA
VLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQP
PPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRIS
EAYESLVKSTTKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDK
AAEGHYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELR
EKQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNGQPANMPE
YNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHFAMNAAATAAAERDTTIINHS
RNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDA
GKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEH
ASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLS
TTPAHSPVLKHPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgtggagggcaaagttgcgccggggaacttgtgagcctgcggtgaaagggtccccttct
gcttgttatagccccagtagtcctgtccaggttctagaagactccacctacttttcccca
gactttcagctctattctgggaggcatgaaacatctgctttgacggtggaggcaaccagt
agcatcagggaaaaagttgttgaagatcctctttgtaacttccactccccaaacttcctg
aggatctcagaggtggaaatgagaggttccgaggatgcggcagctggaacagtattgcag
cggctgatccaggaacaactgcggtatggcaccccaaccgagaacatgaacttgctggcc
attcagcaccaggccacagggagtgcaggaccagcccatcctacaaacaacttttcttcc
acggaaaacctcactcaagaagacccacaaatggtctaccagtcagcacgccaagaaccg
cagggtcaagaacaccaggtggacaatacggtgatggagaaacaggtccggtccacgcag
cctcagcagaacaacgaggaactgcccacttacgaggaggccaaagcacagtcgcagttc
ttcagggggcagcagcagcagcaacagcagcagggggcggtgggccatggttactacatg
gcagggggcaccagtcagaagtcccgaactgaggggaggcccactgtgaaccgtgccaac
agtggacaggcgcataaggacgaggcgctgaaggaactgaagcagggccacgtccgctcg
ctcagcgagagaatcatgcagctgtccctggagaggaatggggccaagcaacaccttccc
ggctcggggaatggaaagggcttcaaagtaggaggggggccctcccctgcccagcctgca
ggtaaagtgctggaccctcggggtcctccacctgagtaccccttcaagaccaagcaaatg
atgtccccagtcagcaagacccaggagcacggacttttttatggtgaccagcaccccggg
atgctccacgagatggtcaagccctaccctgctcctcagcctgtgagaacagatgtggcc
gtcctgcggtaccagccaccccctgagtatggggtaacgagccgcccatgccaacttccg
ttcccatcaaccatgcagcagcacagccccatgtcctcccagacctcttccgccagcggg
ccactgcactctgtctccctgccgcttccactcccgatggccctgggtgctccacagccc
ccgcctgccgcctcccccagccagcagcttggtccagatgcctttgcgattgtggagcga
gcccagcaaatggtggagatattaacagaggagaaccgggtgcttcaccaggaacttcag
ggttactacgacaatgccgacaagctccacaagtttgaaaaagaacttcagagaatttcg
gaagcctatgaaagtctggtcaagtctaccaccaagcgagaatcgctggacaaggccatg
agaaacaaattggaaggcgagattagaagacttcatgatttcaacagagacctccgagat
cgactagagactgctaacaggcaactatccagcagggaatacgaagggcatgaagacaaa
gctgcagaggggcattatgcttcccagaacaaagaattcttgaaggaaaaggagaaatta
gaaatggagttagcagcagtgcggactgcaagtgaggaccatcggagacacatcgagatc
ctggaccaggctttgagcaacgcccaggccagggtcatcaagctggaagaggagttacga
gagaagcaagcatatgttgagaaagttgagaagctgcagcaggccctgacccagctgcag
tctgcatgtgagaagcgagaacagatggagcggagactgcggacttggctggagagagag
ctggatgcactgagaacccagcagaaacatggaaatggccagccagccaacatgccggaa
tacaatgccccagccctcctggaacttgtgcgggagaaggaggagcggatcctggccctg
gaggccgacatgacaaagtgggagcagaagtacctggaggagagcaccatccgacacttt
gccatgaatgccgcagccactgcagcagctgagagggacaccacgatcatcaaccactca
cggaatggcagctacggagagagctcgctggaggcccacatctggcaagaggaggaggag
gtggtgcaggccaacagaaggtgtcaggacatggaatacactattaaaaatctccatgcc
aaaatcatagagaaagatgctatgattaaggtcctgcagcagcgatctcgtaaagatgcc
gggaagacagactcctccagcctacgtcctgcccgctccgttccatccatagcagcagct
actgggacacactctcgccagacctctcttaccagcagccagctggctgaggaaaagaag
gaagagaagacctggaaggggagcataggattgctgctggggaaggagcaccatgagcat
gcctctgccccactgctgccacccccacccacctcagcactgtcctccatagcctccact
acggcagccagcagtgcccacgccaagacaggcagcaaggacagcagcacacagactgac
aagagtgccgagctcttctggcccagcatggcctcccttcccagccgcggccggctgagc
acgacccctgctcacagccccgtcctgaaacacccagcggccaaagggaccgcagagaaa
ctggagaactctcctggccatgggaagtcgcctgaccacagaggccgggtcagcagcttg
ctgcacaagcccgagttccctgatggagagatgatggaagtcctcatctaa

KEGG   Homo sapiens (human): 51421
Entry
51421             CDS       T01001                                 

Gene name
AMOTL2, LCCP
Definition
(RefSeq) angiomotin like 2
  KO
K06104  angiomotin like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51421 (AMOTL2)
SSDB
Motif
Pfam: Angiomotin_C
Other DBs
NCBI-GeneID: 51421
NCBI-ProteinID: NP_057285
OMIM: 614658
HGNC: 17812
Ensembl: ENSG00000114019
Vega: OTTHUMG00000159777
Pharos: Q9Y2J4(Tbio)
UniProt: Q9Y2J4
LinkDB
Position
3q22.2
AA seq 780 aa
MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGSPQASLEILAP
EDSQVLQQATRQEPQGQEHQGGENHLAENTLYRLCPQPSKGEELPTYEEAKAHSQYYAAQ
QAGTRPHAGDRDPRGAPGGSRRQDEALRELRHGHVRSLSERLLQLSLERNGARAPSHMSS
SHSFPQLARNQQGPPLRGPPAEGPESRGPPPQYPHVVLAHETTTAVTDPRYRARGSPHFQ
HAEVRILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQ
ASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHE
SLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMV
AKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALGNAQGRAARAEEELRKKQ
AYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGS
PELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIR
HSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQG
SLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTADRAPTEEPVVTAPPAAHA
KHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgaggacactggaagactcctcggggacagtcctgcaccgcctcatccaggagcagctg
cgctacggcaacctgactgagacgcgcacgctgctagccatccagcagcaggccctgagg
ggtggggctggaactgggggtacagggagcccccaggcctccctggagatcctggcccca
gaggacagtcaggtgctgcagcaggccaccaggcaggagccccagggccaggagcaccag
ggcggtgagaaccacctggcagagaacaccctctaccggctatgcccacagcccagcaag
ggagaggagctgcccacctatgaggaggccaaagcccactcgcagtactatgcggcccag
caggcagggacccggccacatgcgggggaccgagatccccgtggggccccgggaggcagt
cggaggcaggacgaggccctgcgggagctgaggcatgggcacgtgcgctcgttgagtgaa
cggctccttcagttgtccctggagaggaacggcgcccgggcccccagccacatgagctcc
tcccacagcttcccacagctggcccgcaaccagcagggccccccactgaggggcccccct
gctgagggcccagagtcccgaggacccccacctcagtaccctcatgttgtactagctcat
gagaccaccactgctgtcactgacccacggtaccgtgcccgcggcagcccgcacttccag
catgctgaagtcaggatcctgcaggcccaggtgcctcctgtgttcctccaacagcagcag
cagtaccagtacctgcagcaatctcaggagcacccccctcccccacatccagctgctctc
ggccatggccccctgagctccctcagtccacctgctgtggaggggccagtgagtgcccag
gcctcctcagccacctcgggcagtgcccacctggcccagatggaggccgtgctgagggag
aatgccaggctgcagagagacaatgagcggctgcagagggagctggagagctctgcggag
aaggctggccgcattgagaagctggaaagcgaaatccagcggctctctgaggcccatgag
agcctgaccagagcctcctccaagcgtgaggccctggagaagaccatgcggaacaagatg
gacagtgaaatgaggaggctgcaagacttcaaccgggatcttagagagagattggaatct
gcaaatcgccgcctggcaagcaagacacaggaggcccaggccggcagtcaggacatggtg
gccaagctgcttgctcagagctacgaacagcagcaggagcaagagaagctggagcgagag
atggcactgctgcgcggcgccatcgaggaccagcggcggcgtgccgagctgctggagcag
gctctgggcaatgcgcagggccgggcagctcgagccgaagaggagctgcgcaagaagcag
gcctatgtggagaaagtggagcggctgcagcaggcgctcgggcagctgcaggcagcctgt
gagaagcgggagcagctggagctgcgtctgcggactcgcctggagcaggaactcaaggcc
ctgcgtgcacagcagagacaggcaggtgccccaggtggtagcagtggcagtggtgggtct
ccagagctcagcgccctgcgactgtcagaacaactgcgagagaaggaggagcagatcctg
gcgctggaggccgacatgaccaagtgggagcagaagtatttggaggaacgtgccatgagg
cagtttgccatggatgcggctgccacggctgctgctcagcgtgacaccactctcatccga
cattccccccagccctcacccagcagcagcttcaatgagggtctgctcactggtggccac
aggcatcaggagatggaaagcaggttaaaggtgctccatgcccagatcctggagaaggat
gcagtgatcaaggtccttcagcagcgctccaggagagaccctggcaaggccatccagggc
tccctgcggcctgccaagtcggtgccatctgttttcgcggctgcggcagcaggaacccag
ggctggcaagggctctcttctagtgagcgacaaacagcagacgcccctgctcggctgact
acagcagacagagcacccacagaggagccagtggtcacagctccccctgctgcccatgcc
aaacacgggagcagagatgggagcacccagactgagggccccccagacagcacctccacc
tgcctgccaccggagcctgacagccttctggggtgcagcagtagccagagagcagcctct
ctggactctgtagctacatccagagtccaggacttgtcagacatggtggagatactgatc
tga

DBGET integrated database retrieval system