KEGG   Homo sapiens (human): 1551Help
Entry
1551              CDS       T01001                                 

Gene name
CYP3A7, CP37, CYPIIIA7, P-450(HFL33), P-450111A7, P450-HFLA
Definition
(RefSeq) cytochrome P450 family 3 subfamily A member 7
  KO
K17691  cytochrome P450 family 3 subfamily A polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Drug target
Cobicistat: D09881
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1551 (CYP3A7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1551 (CYP3A7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1551 (CYP3A7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1551 (CYP3A7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1551 (CYP3A7)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   1551 (CYP3A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1551
NCBI-ProteinID: NP_000756
OMIM: 605340
HGNC: 2640
Ensembl: ENSG00000160870
Vega: OTTHUMG00000156726
Pharos: P24462(Tclin)
UniProt: P24462
LinkDB All DBs
Position
7q22.1
AA seq 503 aa AA seqDB search
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccgtacacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatgctttgtccttccgtaagggctattggacgttt
gacatggaatgttataaaaagtatagaaaagtctggggtatttatgactgtcaacagcct
atgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttcgggccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaacattcaccagcgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaacacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgagcatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaatccattagatccattcgtt
ctctcaataaaagtctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttataagttttctaacaaaatctgtaaaacagataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagactctgagacccacaaagctctgtctgatctggagctcatggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaagtgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgtttattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aaaaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcgtgaacatgaaacttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttctaacagaaaaacccattgttctaaaggctgagtcaagggatgagaccgta
agtggagcctga

DBGET integrated database retrieval system