KEGG   Homo sapiens (human): 1558Help
Entry
1558              CDS       T01001                                 

Gene name
CYP2C8, CPC8, CYP2C8DM, CYPIIC8, MP-12/MP-20
Definition
(RefSeq) cytochrome P450 family 2 subfamily C member 8
  KO
K17718  cytochrome P450 family 2 subfamily C polypeptide 8 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00830  Retinol metabolism
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    1558 (CYP2C8)
   00591 Linoleic acid metabolism
    1558 (CYP2C8)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1558 (CYP2C8)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    1558 (CYP2C8)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    1558 (CYP2C8)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1558 (CYP2C8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1558 (CYP2C8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1558 (CYP2C8)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1558 (CYP2C8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1558
NCBI-ProteinID: NP_000761
OMIM: 601129
HGNC: 2622
Ensembl: ENSG00000138115
Vega: OTTHUMG00000018804
Pharos: P10632(Tbio)
UniProt: P10632
LinkDB All DBs
Structure
PDB: 

Position
10q23.33
AA seq 490 aa AA seqDB search
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaccttttgtggtcctggtgctgtgtctctcttttatgcttctcttttcactctgg
agacagagctgtaggagaaggaagctccctcctggccccactcctcttcctattattgga
aatatgctacagatagatgttaaggacatctgcaaatctttcaccaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcccatagtggtgtttcatggatat
gaggcagtgaaggaagccctgattgataatggagaggagttttctggaagaggcaattcc
ccaatatctcaaagaattactaaaggacttggaatcatttccagcaatggaaagagatgg
aaggagatccggcgtttctccctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagctcactgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatcagaattttctcaccctgatgaaaaga
ttcaatgaaaacttcaggattctgaactccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaagtgcttaaaaatgttgctcttaca
cgaagttacattagggagaaagtaaaagaacaccaagcatcactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaaaagtca
gaattcaatattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgatcatgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacactgatgctgtagtgcacgagatccagagatacagtgac
cttgtccccaccggtgtgccccatgcagtgaccactgatactaagttcagaaactacctc
atccccaagggcacaaccataatggcattactgacttccgtgctacatgatgacaaagaa
tttcctaatccaaatatctttgaccctggccactttctagataagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagaaggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgatgatttaaagaacctcaatactactgcagttaccaaagggattgtttctctgcca
ccctcataccagatctgcttcatccctgtctga

DBGET integrated database retrieval system