KEGG   Homo sapiens (human): 157506
Entry
157506            CDS       T01001                                 

Gene name
RDH10, SDR16C4
Definition
(RefSeq) retinol dehydrogenase 10
  KO
K11151  retinol dehydrogenase 10 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    157506 (RDH10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     157506 (RDH10)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 157506
NCBI-ProteinID: NP_742034
OMIM: 607599
HGNC: 19975
Ensembl: ENSG00000121039
Vega: OTTHUMG00000164492
Pharos: Q8IZV5(Tbio)
UniProt: Q8IZV5 A0A024R7X6
LinkDB
Position
8q21.11
AA seq 341 aa
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF
LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaacatcgtggtggagttcttcgtggtcactttcaaagtgctctgggcgttcgtgctg
gccgcggcgcgctggctggtgcggcccaaggagaagagcgtggcgggccaggtgtgcctc
atcaccggcgccggcagcggcctgggccgcctcttcgcgctggagttcgcccggcgtcgg
gcgctgctggtgctgtgggacatcaacacgcaaagcaacgaggagacggctggcatggtg
cgccacatctaccgcgacctggaggcggccgacgccgctgcgctgcaagctgggaatggt
gaggaagaaattctgccccactgtaacttgcaggtttttacctacacctgtgacgtgggg
aagagggagaacgtctacctgacggctgaaagagtccgcaaggaggttggcgaagtctca
gtcctggtcaataatgctggtgtggtctctgggcatcaccttctggaatgtcctgatgag
ctcattgagagaaccatgatggtcaattgccatgcacacttctggaccactaaggctttt
cttcctacgatgctggagattaatcatggtcatattgtgacagttgcaagttccttggga
ttgttcagtactgccggagttgaggattactgtgccagtaaatttggagttgtgggtttt
catgaatccctgagccatgaactaaaggctgctgaaaaggatggaattaaaacaaccttg
gtttgcccttatcttgtagacactggcatgttcagaggctgccgaatcaggaaagaaatt
gagccttttctgccacctctgaagcctgattactgtgtgaagcaggccatgaaggccatc
ctcactgaccagcccatgatctgcactccccgcctcatgtacatcgtgaccttcatgaag
agcatcctaccatttgaagcagttgtgtgcatgtatcggttcctaggagcggacaagtgt
atgtacccctttattgctcaaagaaagcaagccacaaacaataatgaagcaaaaaatgga
atctaa

KEGG   Homo sapiens (human): 51109
Entry
51109             CDS       T01001                                 

Gene name
RDH11, ARSDR1, CGI82, HCBP12, MDT1, PSDR1, RALR1, RDJCSS, SCALD, SDR7C1
Definition
(RefSeq) retinol dehydrogenase 11
  KO
K11152  retinol dehydrogenase 11 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Disease
H02292  Retinal dystrophy, juvenile cataracts, and short stature syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    51109 (RDH11)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     51109 (RDH11)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase AdoHcyase_NAD Shikimate_DH
Other DBs
NCBI-GeneID: 51109
NCBI-ProteinID: NP_057110
OMIM: 607849
HGNC: 17964
Ensembl: ENSG00000072042
Vega: OTTHUMG00000171196
Pharos: Q8TC12(Tbio)
UniProt: Q8TC12 A0A0S2Z583
LinkDB
Position
14q24.1
AA seq 318 aa
MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKE
LAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKH
LHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAH
HLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELV
RHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNET
IARRLWDVSCDLLGLPID
NT seq 957 nt   +upstreamnt  +downstreamnt
atggttgagctcatgttcccgctgttgctcctccttctgcccttccttctgtatatggct
gcgccccaaatcaggaaaatgctgtccagtggggtgtgtacatcaactgttcagcttcct
gggaaagtagttgtggtcacaggagctaatacaggtatcgggaaggagacagccaaagag
ctggctcagagaggagctcgagtatatttagcttgccgggatgtggaaaagggggaattg
gtggccaaagagatccagaccacgacagggaaccagcaggtgttggtgcggaaactggac
ctgtctgatactaagtctattcgagcttttgctaagggcttcttagctgaggaaaagcac
ctccacgttttgatcaacaatgcaggagtgatgatgtgtccgtactcgaagacagcagat
ggctttgagatgcacataggagtcaaccacttgggtcacttcctcctaacccatctgctg
ctagagaaactaaaggaatcagccccatcaaggatagtaaatgtgtcttccctcgcacat
cacctgggaaggatccacttccataacctgcagggcgagaaattctacaatgcaggcctg
gcctactgtcacagcaagctagccaacatcctcttcacccaggaactggcccggagacta
aaaggctctggcgttacgacgtattctgtacaccctggcacagtccaatctgaactggtt
cggcactcatctttcatgagatggatgtggtggcttttctcctttttcatcaagactcct
cagcagggagcccagaccagcctgcactgtgccttaacagaaggtcttgagattctaagt
gggaatcatttcagtgactgtcatgtggcatgggtctctgcccaagctcgtaatgagact
atagcaaggcggctgtgggacgtcagttgtgacctgctgggcctcccaatagactaa

KEGG   Homo sapiens (human): 5959
Entry
5959              CDS       T01001                                 

Gene name
RDH5, 9cRDH, HSD17B9, RDH1, SDR9C5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
Disease
H00825  Familial flecked retina syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    5959 (RDH5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     5959 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 5959
NCBI-ProteinID: NP_001186700
OMIM: 601617
HGNC: 9940
Ensembl: ENSG00000135437
Vega: OTTHUMG00000170126
Pharos: Q92781(Tbio)
UniProt: Q92781 A0A024RB18
LinkDB
Position
12q13.2
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQSLPASNAFVFITGCDSGFGRLLALQLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDITDPQSVQQAAKWVEMHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQAHYGGA
FLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctcttctgctgggtgccttactctgggcagtgctgtggttgctcagggac
cggcagagcctgcccgccagcaatgcctttgtcttcatcaccggctgtgactcaggcttt
gggcgccttctggcactgcagctggaccagagaggcttccgagtcctggccagctgcctg
accccctccggggccgaggacctgcagcgggtggcctcctcccgcctccacaccaccctg
ttggatatcactgatccccagagcgtccagcaggcagccaagtgggtggagatgcacgtt
aaggaagcagggctttttggtctggtgaataatgctggtgtggctggtatcatcggaccc
acaccatggctgacccgggacgatttccagcgggtgctgaatgtgaacacaatgggtccc
atcggggtcacccttgccctgctgcctctgctgcagcaagcccggggccgggtgatcaac
atcaccagcgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaaattt
ggcctggaggccttctctgacagcctgaggcgggatgtagctcattttgggatacgagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagtctggagaaa
accctgcaggcctgctgggcacggctgcctcctgccacacaggcccactatgggggggcc
ttcctcaccaagtacctgaaaatgcaacagcgcatcatgaacctgatctgtgacccggac
ctaaccaaggtgagccgatgcctggagcatgccctgactgctcgacacccccgaacccgc
tacagcccaggttgggatgccaagctgctctggctgcctgcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccaagcagtctactga

DBGET integrated database retrieval system