KEGG   Homo sapiens (human): 1579
Entry
1579              CDS       T01001                                 

Gene name
CYP4A11, CP4Y, CYP4A2, CYP4AII, CYPIVA11
Definition
(RefSeq) cytochrome P450 family 4 subfamily A member 11
  KO
K17687  cytochrome P450 family 4 subfamily A11 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1579 (CYP4A11)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1579 (CYP4A11)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   1579 (CYP4A11)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1579
NCBI-ProteinID: NP_000769
OMIM: 601310
HGNC: 2642
Ensembl: ENSG00000187048
Vega: OTTHUMG00000008020
Pharos: Q02928(Tbio)
UniProt: Q02928
LinkDB
Position
1p33
AA seq 519 aa
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLF
GHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL
LPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccccagcagactcctgggtgatgtctctggaatcctccaa
gcggcctccctgctcattctgcttctgctgctgatcaaggcagttcagctctacctgcac
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagctccaacaggaccaggagctacaacggattcagaaatgggtggag
acattcccaagtgcctgtcctcattggctatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggttcctac
agattcctggctccatggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccactatgacatcctgaagccctatgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagtgt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatacaggcc
attagtgacctgaacaacctggttttttcccgtgtgaggaatgcctttcaccagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcatttggattttctggatatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccacagcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggcagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacccagaggtgtttgaccctttccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaacgagctgaaggtggccacggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccattgcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

KEGG   Homo sapiens (human): 284541
Entry
284541            CDS       T01001                                 

Gene name
CYP4A22
Definition
(RefSeq) cytochrome P450 family 4 subfamily A member 22
  KO
K17687  cytochrome P450 family 4 subfamily A11 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    284541 (CYP4A22)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     284541 (CYP4A22)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   284541 (CYP4A22)
SSDB
Motif
Pfam: p450 Proton_antipo_M
Other DBs
NCBI-GeneID: 284541
NCBI-ProteinID: NP_001010969
OMIM: 615341
HGNC: 20575
Ensembl: ENSG00000162365
Vega: OTTHUMG00000007845
Pharos: Q5TCH4(Tbio)
UniProt: Q5TCH4
LinkDB
Position
1p33
AA seq 519 aa
MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLF
GHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
KFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHEND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL
LPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtcctgagccccagcagacgcctgggtggtgtctccgggatcctccaa
gtgacctccctgctcattctgcttctgctgctgatcaaggcagctcagctctacctgcat
aggcagtggctgctcaaagccctccagcagttcccgtgccctccctcccactggctcttc
gggcacatccaggagttccaacacgaccaggagctacaacggattcaggaacgggtgaag
acattcccaagtgcctgtccttattggatatggggaggcaaagttcgtgtccagctctat
gaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggatcctac
aaattcctggctccacggattgggtacggcttgctcctgttgaatgggcagacatggttc
cagcatcgacggatgctgaccccagccttccacaatgacatcctgaagccatacgtgggg
ctcatggcagactctgtacgagtgatgctggacaaatgggaagagctccttggccaggat
tcccctctggaggtctttcagcacgtctccttgatgaccctggacaccatcatgaagagt
gccttcagccatcagggcagcatccaggtggacaggaattctcagtcctacatccaggcc
attagtgacctgaacagcctggttttttgctgtatgaggaatgcctttcatgagaatgac
accatctacagcctgacctctgctggccgctggacacaccgcgcctgccagctggcccat
cagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggggagctg
gagaagatcaagaggaagaggcacttggattttctggacatcctcctcttggccaaaatg
gagaatgggagcatcttgtcagacaaggacctccgtgctgaggtggacacgttcatgttt
gagggccacgacaccacagccagtgggatctcctggatcctctatgctctggccacacac
cccaagcatcaggagaggtgccgggaggagatccatggcctcctgggtgatggagcctcc
atcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggaggcactg
aggctctacccaccggtgccaggcattggaagagagctcagcactcccgtcaccttccct
gatgggcgctccttgcccaaaggtatcatggtcctcctctccatttatggccttcaccac
aacccaaaagtgtggcccaacctagaggtgtttgacccttcccgttttgcaccgggttct
gctcaacacagccacgctttcctgcccttctcaggaggatcaaggaactgcatcgggaaa
caatttgccatgaaccagctgaaggtggccagggccctgaccctgctccgctttgagctg
ctgcctgatcccaccaggatccccatccccatggcacgacttgtgttgaaatccaaaaat
ggaatccacctgcgtctcaggaggctccctaacccttgtgaagacaaggaccagctttga

DBGET integrated database retrieval system