KEGG   Homo sapiens (human): 1581
Entry
1581              CDS       T01001                                 

Gene name
CYP7A1, CP7A, CYP7, CYPVII
Definition
(RefSeq) cytochrome P450 family 7 subfamily A member 1
  KO
K00489  cholesterol 7alpha-monooxygenase [EC:1.14.14.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04976  Bile secretion
hsa04979  Cholesterol metabolism
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
N00808  CYP27A1 deficiency in bile acid biosynthesis
N00809  AKR1D1 deficiency in bile acid biosynthesis
N00810  HSD3B7 deficiency in bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    1581 (CYP7A1)
   00140 Steroid hormone biosynthesis
    1581 (CYP7A1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    1581 (CYP7A1)
  09154 Digestive system
   04976 Bile secretion
    1581 (CYP7A1)
   04979 Cholesterol metabolism
    1581 (CYP7A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1581 (CYP7A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.23  cholesterol 7alpha-monooxygenase
     1581 (CYP7A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP7 family
   1581 (CYP7A1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1581
NCBI-ProteinID: NP_000771
OMIM: 118455
HGNC: 2651
Ensembl: ENSG00000167910
Vega: OTTHUMG00000164301
Pharos: P22680(Tbio)
UniProt: P22680
LinkDB
Structure
PDB: 
3V8D 3DAX 3SN5

Position
8q12.1
AA seq 504 aa
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN
TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF
EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgatgaccacatctttgatttgggggattgctatagcagcatgctgttgtctatggctt
attcttggaattaggagaaggcaaacgggtgaaccacctctagagaatggattaattcca
tacctgggctgtgctctgcaatttggtgccaatcctcttgagttcctcagagcaaatcaa
aggaaacatggtcatgtttttacctgcaaactaatgggaaaatatgtccatttcatcaca
aatcccttgtcataccataaggtgttgtgccacggaaaatattttgattggaaaaaattt
cactttgctacttctgcgaaggcatttgggcacagaagcattgacccgatggatggaaat
accactgaaaacataaacgacactttcatcaaaaccctgcagggccatgccttgaattcc
ctcacggaaagcatgatggaaaacctccaacgtatcatgagacctccagtctcctctaac
tcaaagaccgctgcctgggtgacagaagggatgtattctttctgctaccgagtgatgttt
gaagctgggtatttaactatctttggcagagatcttacaaggcgggacacacagaaagca
catattctaaacaatcttgacaacttcaagcaattcgacaaagtctttccagccctggta
gcaggcctccccattcacatgttcaggactgcgcacaatgcccgggagaaactggcagag
agcttgaggcacgagaacctccaaaagagggaaagcatctcagaactgatcagcctgcgc
atgtttctcaatgacactttgtccacctttgatgatctggagaaggccaagacacacctc
gtggtcctctgggcatcgcaagcaaacaccattccagcgactttctggagtttatttcaa
atgattaggaacccagaagcaatgaaagcagctactgaagaagtgaaaagaacattagag
aatgctggtcaaaaagtcagcttggaaggcaatcctatttgtttgagtcaagcagaactg
aatgacctgccagtattagatagtataatcaaggaatcgctgaggctttccagtgcctcc
ctcaacatccggacagctaaggaggatttcactttgcaccttgaggacggttcctacaac
atccgaaaagatgacatcatagctctttacccacagttaatgcacttagatccagaaatc
tacccagaccctttgacttttaaatatgataggtatcttgatgaaaacgggaagacaaag
actaccttctattgtaatggactcaagttaaagtattactacatgccctttggatcggga
gctacaatatgtcctggaagattgttcgctatccacgaaatcaagcaatttttgattctg
atgctttcttattttgaattggagcttatagagggccaagctaaatgtccacctttggac
cagtcccgggcaggcttgggcattttgccgccattgaatgatattgaatttaaatataaa
ttcaagcatttgtga

KEGG   Homo sapiens (human): 9420
Entry
9420              CDS       T01001                                 

Gene name
CYP7B1, CBAS3, CP7B, SPG5A
Definition
(RefSeq) cytochrome P450 family 7 subfamily B member 1
  KO
K07430  25/26-hydroxycholesterol 7alpha-hydroxylase [EC:1.14.14.29]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
N00808  CYP27A1 deficiency in bile acid biosynthesis
N00809  AKR1D1 deficiency in bile acid biosynthesis
N00810  HSD3B7 deficiency in bile acid biosynthesis
N00811  CYP7B1 deficiency in bile acid biosynthesis
Disease
H00266  Hereditary spastic paraplegia
H00628  Congenital bile acid synthesis defect
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    9420 (CYP7B1)
   00140 Steroid hormone biosynthesis
    9420 (CYP7B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    9420 (CYP7B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.29  25/26-hydroxycholesterol 7alpha-hydroxylase
     9420 (CYP7B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP7 family
   9420 (CYP7B1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9420
NCBI-ProteinID: NP_004811
OMIM: 603711
HGNC: 2652
Ensembl: ENSG00000172817
Vega: OTTHUMG00000164387
Pharos: O75881(Tbio)
UniProt: O75881 Q05C57
LinkDB
Position
8q12.3
AA seq 506 aa
MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPYLGVVL
NLRKDPLRFMKTLQKQHGDTFTVLLGGKYITFILDPFQYQLVIKNHKQLSFRVFSNKLLE
KAFSISQLQKNHDMNDELHLCYQFLQGKSLDILLESMMQNLKQVFEPQLLKTTSWDTAEL
YPFCSSIIFEITFTTIYGKVIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKS
IREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
MFWAMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLESSIFEAL
RLSSYSTTIRFVEEDLTLSSETGDYCVRKGDLVAIFPPVLHGDPEIFEAPEEFRYDRFIE
DGKKKTTFFKRGKKLKCYLMPFGTGTSKCPGRFFALMEIKQLLVILLTYFDLEIIDDKPI
GLNYSRLLFGIQYPDSDVLFRYKVKS
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggcaggagaagtgtccgcggccacgggccgcttttcgctggagcggttgggcctcccg
ggcctggccctcgccgcggccctgctgctcctggccctctgcttgcttgtccggcgcacc
aggagacccggtgagcctccattgataaaaggttggcttccttatcttggagtggtcctg
aacttacgaaaagaccccttaaggttcatgaaaacacttcaaaagcaacatggtgacact
ttcacagttcttcttggtggaaagtacataacatttatcctggaccccttccagtaccag
ctagtgataaaaaatcataaacaattaagctttcgagtattttctaataaattattagag
aaagcatttagcatcagtcagttgcaaaaaaatcatgacatgaatgatgagcttcacctc
tgctatcaatttttgcaaggcaaatctttggacatactcttggaaagcatgatgcagaat
ctaaaacaagtttttgaaccccagctgttaaaaaccacaagttgggacacggcagaactg
tatccattctgcagctcaataatatttgagatcacatttacaactatatatggaaaagtt
attgtttgtgacaacaacaaatttattagtgagctaagagatgattttttaaaatttgat
gacaagtttgcatatttagtatccaacatacccattgagcttctaggaaatgtcaagtct
attagagagaaaattataaaatgcttctcatcagaaaagttagccaagatgcaaggatgg
tcagaagtttttcaaagcaggcaagatgtcctggagaaatattatgtgcacgaggacctt
gaaataggagcacatcatttaggctttctctgggcctctgtggcaaacactattccaact
atgttctgggcaatgtattatcttctgcggcacccagaagctatggcagcagtgcgtgac
gaaattgaccgtttgctgcagtcaacaggtcaaaagaaagggtctggatttcccatccac
ctcaccagagaacaattggacagcctaatctgcctagaaagcagcatttttgaagcttta
cgactgtcctcatattcaaccaccattcgttttgttgaggaggatttgactctcagttca
gagaccggggactactgtgtgcgaaagggagacttggtagccatctttcctccagtccta
catggtgaccctgaaatctttgaagctccagaggagtttagatatgatcgttttatagaa
gatggtaagaagaaaaccacctttttcaaaagagggaaaaagctgaagtgttacctaatg
ccgtttggaactggaaccagcaaatgtccaggccgattttttgcacttatggaaataaaa
caattgttggttatacttttaacttattttgatttagaaataattgatgataagcccata
ggactaaactacagccgcttgttgtttggtattcagtatccagattctgatgttttattt
agatacaaagtgaaatcttag

KEGG   Homo sapiens (human): 51302
Entry
51302             CDS       T01001                                 

Gene name
CYP39A1
Definition
(RefSeq) cytochrome P450 family 39 subfamily A member 1
  KO
K07439  24-hydroxycholesterol 7alpha-hydroxylase [EC:1.14.14.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
N00808  CYP27A1 deficiency in bile acid biosynthesis
N00809  AKR1D1 deficiency in bile acid biosynthesis
N00810  HSD3B7 deficiency in bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    51302 (CYP39A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    51302 (CYP39A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.26  24-hydroxycholesterol 7alpha-hydroxylase
     51302 (CYP39A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP39 family
   51302 (CYP39A1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 51302
NCBI-ProteinID: NP_057677
OMIM: 605994
HGNC: 17449
Ensembl: ENSG00000146233
Vega: OTTHUMG00000014785
Pharos: Q9NYL5(Tbio)
UniProt: Q9NYL5
LinkDB
Position
6p12.3
AA seq 469 aa
MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKY
GPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLY
IMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLF
STNKKKIKEFHQYFQVYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAK
DNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAIM
EGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIP
SGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFA
LLEVQMCIILILYKYDCSLLDPLPKQSYLHLVGVPQPEGQCRIEYKQRI
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggaactaatttccccaacagtgattataatcctgggttgccttgctctgttcttactc
cttcagcggaagaatttgcgtagacccccgtgcatcaagggctggattccttggattgga
gttggatttgagtttgggaaagcccctctagaatttatagagaaagcaagaatcaagtat
ggaccaatatttacagtctttgctatgggaaaccgaatgacctttgttactgaagaagaa
ggaattaatgtgtttctaaaatccaaaaaagtagattttgaactagcagtgcaaaatatc
gtttatcgtacagcatcaattccaaagaatgtctttttagcactgcatgaaaaactctat
attatgttgaaagggaaaatggggactgtcaatctccatcagtttactgggcaactgact
gaagaattacatgaacaactggagaatttaggcactcatgggacaatggacctgaacaac
ttagtaagacatctcctttatccagtcacagtgaatatgctctttaataaaagtttgttt
tccacaaacaagaaaaaaatcaaggagttccatcagtattttcaagtttatgatgaagat
tttgagtatgggtcccagttgccagagtgtcttctaagaaactggtcaaaatccaaaaag
tggttcctggaactgtttgagaaaaacattccagatataaaagcatgtaaatctgcaaaa
gataattccatgacattattgcaagctacgctggatattgtagagacggaaacaagtaag
gaaaactcacccaattatgggctcttactgctttgggcttctctgtctaatgctgttcct
gttgcattttggacacttgcatacgtcctttctcatcctgatatccacaaggccattatg
gaaggcatatcttctgtgtttggcaaagcaggcaaagataagattaaagtgtctgaggat
gacctggagaatctccttctaattaaatggtgtgttttggaaaccattcgtttaaaagct
cctggtgtcattactagaaaagtggtgaagcctgtggaaattttgaattacatcattcct
tctggtgacttgttgatgttgtctccattttggctgcatagaaatccaaagtattttcct
gagcctgaattgttcaaacctgaacgttggaaaaaggcaaatttagagaagcactctttc
ttggactgcttcatggcatttggaagcgggaagttccagtgtcctgcaaggtggtttgct
ctgttagaggttcagatgtgtattattttaatactttataaatatgactgtagtcttctg
gacccattacccaaacagagttatctccatttggtgggtgtcccccagccggaagggcaa
tgccgaattgaatataaacaaagaatatga

DBGET integrated database retrieval system