KEGG   Homo sapiens (human): 158326Help
Entry
158326            CDS       T01001                                 

Gene name
FREM1, BNAR, C9orf143, C9orf145, C9orf154, MOTA, TILRR, TRIGNO2
Definition
(RefSeq) FRAS1 related extracellular matrix 1
  KO
K23380  FRAS1-related extracelluar matrix protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Disease
H00685  Bifid nose with or without anorectal and renal anomalies
H00686  Manitoba oculotrichoanal syndrome
H01207  Trigonocephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    158326 (FREM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin_3 Big_9 Cadherin_4 Lectin_C Calx-beta
Motif
Other DBs
NCBI-GeneID: 158326
NCBI-ProteinID: NP_659403
OMIM: 608944
HGNC: 23399
Ensembl: ENSG00000164946
Vega: OTTHUMG00000019575
Pharos: Q5H8C1(Tbio)
UniProt: Q5H8C1
LinkDB All DBs
Position
9p22.3
AA seq 2179 aa AA seqDB search
MNSLSWGAANAVLLLLLLAWASPTFISINRGVRVMKGHSAFLSGDDLKFAIPKEKDACKV
EVVMNEPITQRVGKLTPQVFDCHFLPNEVKYVHNGCPILDEDTVKLRLYRFTERDTFIET
FILWVYLLEPDCNIIHMSNNVLEVPEFNGLSQAIDKNLLRFDYDRMASLECTVSLDTART
RLPAHGQMVLGEPRPEEPRGDQPHSFFPESQLRAKLKCPGGSCTPGLKKIGSLKVSCEEF
LLMGLRYQHLDPPSPNIDYISIQLDLTDTRSKIVYKSESAWLPVYIRAGIPNQIPKAAFM
AVFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFTW
KDLSDMQIAYQPPNSSHSERRHDEVELEVYDFFFERSAPMTVHISIRTADTNAPRVSWNT
GLSLLEGQSRAITWEQFQVVDNDDIGAVRLVTVGGLQHGWLTLRGGKGFLFTVADLQAGV
VRYHHDDSDSTKDFVVFRIFDGHHSIRHKFPINVLPKDDSPPFLITNVVIELEEGQTILI
QGSMLRASDVDASDDYIFFNITKPPQAGEIMKKPGPGLIGYPVHGFLQRDLFNGIIYYRH
FGGEIFEDSFQFVLWDSHEPPNLSVPQVATIHITPVDDQLPKEAPGVSRHLVVKETEVAY
ITKKQLHFIDSESYDRELVYTITTPPFFSFSHRHLDAGKLFMVDSIPKVVKNPTALELRS
FTQHAVNYMKVAYMPPMQDIGPHCRDVQFTFSVSNQHGGTLHGICFNITILPVDNQVPEA
FTNPLKVTEGGQSIISTEHILISDADTKLDNIDLSLRELPLHGRVELNGFPLNSGGTFSW
GDLHTLKVRYQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMN
CSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVT
YKHTGGEIGLMPCFDTITLVVSDGEAGPFVNGCCYNGPNPSVPLHASFPVYDLNITVYPV
DNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSV
GFEKSNIGISIDSFQWKDMNAFHINYVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSII
INPTNDEAPDFVVQNITVCEGQMKELDSSIISAVDLDIPQDALLFSITQKPRHGLLIDRG
FSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKI
LKTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYYVFERLPQ
NGQLQLKIGRDWVPLSPGMKCTQEEVDLNLLRYTHTGAMDSQNQDSFTFYLWDGNNRSPA
LDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPRYG
QIEYVHYPGVPITNFSQMDVVGQTVCYVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLE
TVDRALPVVTRNKGLRLAQGAVGLLSPDLLQLTDPDTPAENLTFLLVQLPQHGQLYLWGT
GLLQHNFTQQDVDSKNVAYRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQV
DQLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGH
LENTTTGEFIHEKFSQKDLNSKTILYIINPSLEVNSDTVEFQIMDPTGNSATPQILELKW
SHIEWSQTEYEVCENVGLLPLEIIRRGYSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQF
DPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSYS
SNQSKHSTWEKGIWHLLPPGSSSSTTSGSFHLERRPLPSSMQLAVIRGDTLRGFDSTDLS
QRKLRTRGNGKTVRPSSVYRNGTDIIYNYHGIVSLKLEDDSFPTHKRKAKVSIISQPQKT
IKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWKA
WSPQTKDVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMR
WLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKW
QTKDCRRAKPHNYVCSRKL
NT seq 6540 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctgagttggggggctgcgaatgccgtgctgctgctgctcctcctggcctgg
gccagccccaccttcatcagcatcaaccgcggggtgagggtgatgaagggccactctgcc
ttcctgtcaggagatgacctgaagtttgccatccctaaagagaaagatgcctgcaaagtg
gaagttgtgatgaatgagccaataacccagagggttgggaaactcactccacaggtcttt
gactgccatttccttcccaacgaagtcaagtatgttcacaatggttgtccaattcttgat
gaagacacagtgaagctcagactttacagatttactgaaagagataccttcatagaaact
tttatcctgtgggtctatctcctggaaccagactgtaacatcatccatatgagtaacaat
gtgctggaggtgcctgaattcaatggcttgtcccaagcgattgataaaaatctgctcaga
ttcgattatgataggatggctagcctggaatgtaccgtcagcctggacactgcgagaact
cggctgccagcccatggccagatggttctcggggagcctcgaccagaagaacctcgtgga
gatcagccacacagttttttcccagagtcccaactgagagcaaaactgaagtgtccaggt
gggagctgtaccccaggattaaagaaaataggaagcctcaaagtgagctgtgaggagttc
ctgctgatgggccttcgttatcagcatctggatcccccttcacccaacattgattatatc
tccatccaactggacctcacagataccaggagcaaaattgtgtacaagtcagagagtgcg
tggctgcctgtctatatcagagctggaattccgaatcagattccaaaggctgcattcatg
gccgtgtttattctggaagtggatcagttcatcctgacctccttgactacatcagttctg
gactgtgaagaagatgagacccctaaacccttgctggtgttcaacattactaaagccccg
ctccagggctatgtgactcacctgttggatcacaccagaccaatctcctcattcacctgg
aaagatctcagtgacatgcagatcgcctatcagccaccaaacagcagccattctgagagg
agacatgatgaggtagaattggaggtatacgacttcttctttgaaaggagtgcacctatg
acagtccacatctccatcagaacagcagatacaaatgccccccgtgtatcctggaataca
ggtctgagtctccttgaggggcagtctcgagccatcacttgggaacagtttcaggttgtc
gacaatgacgacattggtgctgtccggctagtcaccgttggtggcctgcagcatggatgg
ctgactttaagaggggggaaagggtttctcttcaccgtggctgacctccaggctggagtt
gttcgctatcatcatgatgacagcgactccaccaaagacttcgtggtcttccggatattt
gatggccatcacagcatccgtcacaaattccccatcaacgtcttgcccaaagatgatagt
cccccgttcctcataaccaatgttgtgattgaactggaggaggggcagaccatcctgatc
cagggatccatgctgcgagcttcagatgtggacgccagtgatgactacatcttcttcaat
atcacaaagcctccacaggctggggagatcatgaagaagccagggccaggactgataggc
tatcctgtccatggcttccttcagagggatttgtttaatggaatcatttattatcgtcat
tttggtggagaaatctttgaagattcttttcaatttgtcctgtgggacagccatgaacct
ccaaatctttcagtgccacaggtggcaacaatccatataactccagtggatgaccagctt
ccaaaagaggctcctggagtttctcggcatttggttgtcaaggaaactgaggtggcctat
ataactaagaaacagctacattttatagattcagaatcatatgacagggagctggtctac
acaataactactcctccatttttctccttcagccacagacacttggatgctgggaaatta
tttatggtggacagcataccaaaagtagttaagaatcctacggccctggagctgaggtca
ttcactcagcatgctgtgaactatatgaaagtggcctacatgccccccatgcaagacatt
ggtccccattgcagagatgtccagttcacattttctgtcagtaaccaacatggcggtact
ttgcatgggatctgctttaacattacaatcctcccagtggacaatcaagttcctgaggcg
ttcaccaaccctctgaaagtgactgagggaggtcaaagcatcatcagcacagagcacatt
ctaatttctgatgcagataccaagctggacaatattgacctctccctgcgggaattgcct
ctgcacggaagggtggagctgaatggatttcctctaaattcagggggcacattttcttgg
ggcgatctccataccttaaaagttaggtatcaacatgatggaactgaagttcttcaggat
gacctactcttggaggtcaccgatggcacaaattcagcagaatttgtactacatgttgag
gtattccctgtcaacgatgagccaccagtcttaaaggctgacctcatgcctgtcatgaat
tgctcagagggaggagaggtggtcatcacctctgaatacatttttgctactgatgtggac
agcgataacttgaagttgatgtttgtgattgctcgcgaacctcagcatggggtggtgagg
agagctggagtcacagtggatcagttctctcagagagatgttatctcagaggccgtgaca
tacaaacacacaggtggcgagattggcctgatgccttgttttgacaccattacattggtg
gtttcggatggagaggctggcccttttgtgaatggctgttgctacaatggacccaatcca
tctgttccacttcatgcgtcctttccagtgtatgatctcaacatcacggtatacccagta
gacaaccagccaccttccattgcaataggtcccgtgtttgttgtagatgagggctgctca
acagcccttactgttaaccatttgtccgccactgaccctgacactgcagcagatgacttg
gaatttgttttggtttctcctcctcagtttggctacctcgaaaatatactcccttctgtg
ggttttgaaaaaagcaatattggcataagtatagattcatttcagtggaaagacatgaac
gcttttcacattaactatgtgcagtccaggcatctgaggatagaaccaactgccgaccag
ttcacggtgtacgtcacagatgggaagcatcactccttggagataccattttctattata
atcaaccccacaaatgatgaagctcctgactttgtagtgcagaatattactgtgtgtgag
ggtcagatgaaagagctggactcttccatcatcagcgctgtggacctggacattccccag
gatgccctgctgttcagcatcactcaaaagccacgccatggcctcctcatcgataggggg
tttagcaaagacttctctgagaataagcagccagccaaccctcaccagaaacatgcacct
gttcacagcttttccatggaactcctcaagactggaatgaggttgacgtacatgcatgat
gactcagagagccttgctgatgattttacaatccaattgtcagatgggaaacataagata
cttaaaaccatttcagtagaggtcatcccagttaatgatgaaaaaccaatgctgagcaag
aaggctgaaattgcaatgaatatgggtgaaactcgtattatttccagtgctattctttca
gccatagatgaagactcacccagggagaagatttactatgtatttgaaaggcttccccaa
aatgggcaacttcagcttaagatagggagggactgggttcctctctcccctggcatgaaa
tgcactcaggaggaagtggatctgaacttgctgagatacacacacaccggggcaatggat
tcccagaatcaagatagcttcaccttctacctttgggatggcaacaacaggtcccctgct
cttgactgtcaaatcaccatcaaggacatggaaaaaggtgatattgtcatccttacaaaa
ccactcgtggtgtctaaaggtgatagaggtttcttaacaaccaccacgctcctggctgtg
gacggaacagacaagcctgaggaactgctctatgtcatcacctcccctccgcgatatggc
cagatcgaatatgttcactatcctggagttcccattacaaacttcagccaaatggatgta
gtggggcagacagtttgctatgtacacaagagcaaggtgactgtctccagtgacagattc
agattcatcatcagcaatggactgcggaccgagcacggggtgtttgagatcacactggag
actgtggacagagccctgcctgtggtaaccaggaacaaggggttgagactggcccaaggg
gccgtgggcctgctttcccctgacctccttcagctgaccgaccctgatacacctgcggag
aacctcaccttcctcttggttcagctcccccagcatggccagctctacctgtgggggaca
gggctacttcaacacaatttcacccagcaggatgtggacagcaagaatgtggcctatcgg
cactcaggaggggactcccagactgactgctttactttcatggccacagatgggacaaac
caaggctttattgtgaatgggagagtgtgggaagaacctgttttattcaccattcaggta
gaccaattggacaaaacagctcctcgtatcacactcttgcattccccttctcaagtgggg
ctcctgaaaaatggctgctacgggatttacatcacttcccgcgtgttgaaggcatcagac
cctgacactgaggacgatcagatcatctttaaaattctacaaggcccaaaacatggacat
ctggagaacacaacaacaggtgaatttatccatgagaaatttagccaaaaggacttaaac
agtaagactattctttacatcataaacccatctttggaagtaaattcagataccgtggaa
tttcaaatcatggaccccacagggaactcggccactcctcaaattttggaactgaagtgg
tctcatattgaatggtcacagaccgaatatgaagtctgtgagaatgtgggtttgttgccc
ttggaaattatcagaaggggatattccatggactcggcctttgtgggtataaaggtcaac
caagtgtcagctgcagttggaaaagatttcaccgtgattccatctaaactgattcagttt
gacccaggaatgtcaactaagatgtggaatatagcaattacctatgacggattagaggaa
gatgatgaggtctttgaagtaattctgaactcccctgtgaatgcagttcttggcacaaag
acaaaagctgcagtgaaaattttggactcaaaaggaggacaatgccatccttcatattcc
tccaaccaaagcaagcacagcacatgggagaagggcatttggcatctgctgcccccaggg
tcttcctcatccaccacttctggttcctttcatctggaaagaagacctcttccatcttcc
atgcagctagcagtcatcaggggagacaccctgcggggctttgattctacagatctttct
caaaggaagcttaggacccgtgggaatggcaaaacagttcgtccatcctctgtttataga
aatggaacagacatcatctataattatcatgggatagtttccttgaaactggaggatgac
agtttcccaactcacaaaaggaaggccaaagtatccatcattagtcagccacaaaagaca
atcaaagtggcagaactgcctcaagcagataaggtggaatccacaactgactcacacttc
cccagacaggaccagttgccctcatttccaaagaactgcactctggaattaaagggactc
ttccattttgaagaaggcatccagaagctgtatcagtgcaatgggatcgcctggaaagcc
tggagtccccaaaccaaggatgtggaagacaaatcctgtccagccgggtggcaccagcac
tcaggctactgtcacatcttgatcacagagcagaaaggcacctggaatgcggctgcccaa
gcttgcagggaacaatacctgggcaaccttgtaactgtattctccaggcagcacatgcgg
tggctctgggacattggtgggagaaagtccttttggataggtttgaacgaccaagtgcat
gctggccactgggagtggatcggtggtgaacctgttgccttcaccaatgggagaagaggg
ccctctcaacgctccaagcttggaaagagctgtgttttggttcaaagacaagggaaatgg
caaacaaaagactgtaggagagccaaacctcataattatgtgtgttccagaaaactctaa

KEGG   Homo sapiens (human): 341640Help
Entry
341640            CDS       T01001                                 

Gene name
FREM2, CRYPTOP, FRASRS2
Definition
(RefSeq) FRAS1 related extracellular matrix 2
  KO
K23380  FRAS1-related extracelluar matrix protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Disease
H00687  Fraser syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    341640 (FREM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin_3 Calx-beta Big_9
Motif
Other DBs
NCBI-GeneID: 341640
NCBI-ProteinID: NP_997244
OMIM: 608945
HGNC: 25396
Ensembl: ENSG00000150893
Vega: OTTHUMG00000016759
Pharos: Q5SZK8(Tbio)
UniProt: Q5SZK8
LinkDB All DBs
Position
13q13.3
AA seq 3169 aa AA seqDB search
MHSAGTPGLSSRRTGNSTSFQPGPPPPPRLLLLLLLLLSLVSRVPAQPAAFGRALLSPGL
AGAAGVPAEEAIVLANRGLRVPFGREVWLDPLHDLVLQVQPGDRCAVSVLDNDALAQRPG
RLSPKRFPCDFGPGEVRYSHLGARSPSRDRVRLQLRYDAPGGAVVLPLVLEVEVVFTQLE
VVTRNLPLVVEELLGTSNALDARSLEFAFQPETEECRVGILSGLGALPRYGELLHYPQVP
GGAREGGAPETLLMDCKAFQELGVRYRHTAASRSPNRDWIPMVVELRSRGAPVGSPALKR
EHFQVLVRIRGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAESPSDLLIFNLT
SPFQPGQGYLVSTDDRSLPLSSFTQRDLRLLKIAYQPPSEDSDQERLFELELEVVDLEGA
ASDPFAFMVVVKPMNTMAPVVTRNTGLILYEGQSRPLTGPAGSGPQNLVISDEDDLEAVR
LEVVAGLRHGHLVILGASSGSSAPKSFTVAELAAGQVVYQHDDRDGSLSDNLVLRMVDGG
GRHQVQFLFPITLVPVDDQPPVLNANTGLTLAEGETVPILPLSLSATDMDSDDSLLLFVL
ESPFLTTGHLLLRQTHPPHEKQELLRGLWRKEGAFYERTVTEWQQQDITEGRLFYRHSGP
HSPGPVTDQFTFRVQDNHDPPNQSGLQRFVIRIHPVDRLPPELGSGCPLRMVVQESQLTP
LRKKWLRYTDLDTDDRELRYTVTQPPTDTDENHLPAPLGTLVLTDNPSVVVTHFTQAQIN
HHKIAYRPPGQELGVATRVAQFQFQVEDRAGNVAPGTFTLYLHPVDNQPPEILNTGFTIQ
EKGHHILSETELHVNDVDTDVAHISFTLTQAPKHGHMRVSGQILHVGGLFHLEDIKQGRV
SYAHNGDKSLTDSCSLEVSDRHHVVPITLRVNVRPVDDEVPILSHPTGTLESYLDVLENG
ATEITANVIKGTNEETDDLMLTFLLEDPPLYGEILVNGIPAEQFTQRDILEGSVVYTHTS
GEIGLLPKADSFNLSLSDMSQEWRIGGNTIQGVTIWVTILPVDSQAPEIFVGEQLIVMEG
DKSVITSVHISAEDVDSLNDDILCTIVIQPTSGYVENISPAPGSEKSRAGIAISAFNLKD
LRQGHINYVQSVHKGVEPVEDRFVFRCSDGINFSERQFFPIVIIPTNDEQPEMFMREFMV
MEGMSLVIDTPILNAADADVPLDDLTFTITQFPTHGHIMNQLINGTVLVESFTLDQIIES
SSIIYEHDDSETQEDSFVIKLTDGKHSVEKTVLIIVIPVDDETPRMTINNGLEIEIGDTK
IINNKILMATDLDSEDKSLVYIIRYGPGHGLLQRRKPTGAFENITLGMNFTQDEVDRNLI
QYVHLGQEGIRDLIKFDVTDGINPLIDRYFYVSIGSIDIVFPDVISKGVSLKEGGKVTLT
TDLLSTSDLNSPDENLVFTITRAPMRGHLECTDQPGVSITSFTQLQLAGNKIYYIHTADD
EVKMDSFEFQVTDGRNPVFRTFRISISDVDNKKPVVTIHKLVVSESENKLITPFELTVED
RDTPDKLLKFTITQVPIHGHLLFNNTRPVMVFTKQDLNENLISYKHDGTESSEDSFSFTV
TDGTHTDFYVFPDTVFETRRPQVMKIQVLAVDNSVPQIAVNKGASTLRTLATGHLGFMIT
SKILKVEDRDSLHISLRFIVTEAPQHGYLLNLDKGNHSITQFTQADIDDMKICYVLREGA
NATSDMFYFAVEDGGGNKLTYQNFRLNWAWISFEKEYYLVNEDSKFLDVVLKRRGYLGET
SFISIGTRDRTAEKDKDFKGKAQKQVQFNPGQTRATWRVRILSDGEHEQSETFQVVLSEP
VLAALEFPTVATVEIVDPGDEPTVFIPQSKYSVEEDVGELFIPIRRSGDVSQELMVVCYT
QQGTATGTVPTSVLSYSDYISRPEDHTSVVRFDKDEREKLCRIVIIDDSLYEEEETFHVL
LSMPMGGRIGSEFPGAQVTIVPDKDDEPIFYFGDVEYSVDESAGYVEVQVWRTGTDLSKS
SSVTVRSRKTDPPSADAGTDYVGISRNLDFAPGVNMQPVRVVILDDLGQPALEGIEKFEL
VLRMPMNAALGEPSKATVSINDSVSDLPKMQFKERIYTGSESDGQIVTMIHRTGDVQYRS
SVRCYTRQGSAQVMMDFEERPNTDTSIITFLPGETEKPCILELMDDVLYEEVEELRLVLG
TPQSNSPFGAAVGEQNETLIRIRDDADKTVIKFGETKFSVTEPKEPGESVVIRIPVIRQG
DTSKVSIVRVHTKDGSATSGEDYHPVSEEIEFKEGETQHVVEIEVTFDGVREMREAFTVH
LKPDENMIAEMQLTKAIVYIEEMSSMADVTFPSVPQIVSLLMYDDTSKAKESAEPMSGYP
VICITACNPKYSDYDKTGSICASENINDTLTRYRWLISAPAGPDGVTSPMREVDFDTFFT
SSKMVTLDSIYFQPGSRVQCAARAVNTNGDEGLELMSPIVTISREEGLCQPRVPGVVGAE
PFSAKLRYTGPEDADYTNLIKLTVTMPHIDGMLPVISTRELSNFELTLSPDGTRVGNHKC
SNLLDYTEVKTHYGFLTDATKNPEIIGETYPYQYSLSIRGSTTLRFYRNLNLEACLWEFV
SYYDMSELLADCGGTIGTDGQVLNLVQSYVTLRVPLYVSYVFHSPVGVGGWQHFDLKSEL
RLTFVYDTAILWNDGIGSPPEAELQGSLYPTSMRIGDEGRLAVHFKTEAQFHGLFVLSHP
ASFTSSVIMSADHPGLTFSLRLIRSEPTYNQPVQQWSFVSDFAVRDYSGTYTVKLVPCTA
PSHQEYRLPVTCNPREPVTFDLDIRFQQVSDPVAAEFSLNTQMYLLSKKSLWLSDGSMGF
GQESDVAFAEGDIIYGRVMVDPVQNLGDSFYCSIEKVFLCTGADGYVPKYSPMNAEYGCL
ADSPSLLYRFKIVDKAQPETQATSFGNVLFNAKLAVDDPEAILLVNQPGSDGFKVDSTPL
FQVALGREWYIHTIYTVRSKDNANRGIGKRSVEYHSLVSQGKPQSTTKSRKKREIRSTPS
LAWEIGAENSRGTNIQHIALDRTKRQIPHGRAPPDGILPWELNSPSSAVSLVTVVGGTTV
GLLTICLTVIAVLMCRGKESFRGKDAPKGSSSSEPMVPPQSHHNDSSEV
NT seq 9510 nt NT seq  +upstreamnt  +downstreamnt
atgcactcagccgggactcccgggttatcctcgcgccggacaggcaactccaccagcttt
caaccaggaccgccaccgccgccccggctgctgctgctgctgctgcttctcctgtcactg
gtaagccgcgtcccggcacagcccgctgccttcggcagggcgttgctgtcccctggtctc
gcgggggctgcaggggtccctgctgaggaggccatagtgctggcgaaccgcggactccgg
gtgcctttcggccgtgaagtctggctggatcccctgcatgacctggtgttgcaggtgcag
cccggggaccgctgcgcggtttcggtactagacaacgacgcactggcccagcgaccgggc
cgcctgagtcccaagcgcttcccgtgcgactttggccctggcgaggtgcgctactctcac
ctgggcgcgcgcagcccgtctcgggaccgcgtccggctgcagctgcgctatgacgcgccc
ggaggggcagtagtgctaccactggtactggaggtggaggtggtcttcacccagctggag
gttgtgactcggaacttgcctctggtcgtggaagagctgctggggaccagcaatgccctg
gacgcgcggagcctggagttcgccttccagcccgagacagaggagtgccgcgtgggcatc
ctgtccggcttgggcgcgctgcctcgctatggagaactcctccactacccgcaggtccct
ggaggagccagagagggaggcgccccggagactctcctgatggactgcaaagctttccag
gaactaggcgtgcgctatcgccacacagccgccagtcgctcaccaaacagggactggata
cccatggtggtggagctgcgttcacgaggggctcctgtgggcagccctgctttgaaacgc
gagcacttccaggttctggtgaggatccgaggaggggccgagaacactgcacccaagccc
agtttcgtggccatgatgatgatggaggtggaccagtttgtactgacggccctgacccca
gacatgctggcagccgaggatgctgagtctccctctgacctgttgatcttcaaccttact
tctccattccagcctggccagggctacttggtgagcaccgatgatcgcagcctgcccctt
tcctccttcactcagagggatctgcggctcctgaagattgcctaccagcccccttctgaa
gactctgaccaggagcgcctctttgaactggaattggaggtagtggatctagaaggagca
gcttcagacccttttgccttcatggtagtggtgaagcccatgaacacaatggctccggtg
gtcacccggaataccggtcttattctctatgagggtcagtctcggcccctcacaggccct
gcaggcagtggtccgcaaaacttggtcatcagcgatgaggatgacctagaagcagtgcgg
ctagaggtggtggctgggctccggcatggtcaccttgtcattctgggtgcttccagtggc
agctctgctcccaagagctttacagtggctgagctggcagccggccaggtggtctaccag
catgatgacagagacggctcgctgagcgacaacctggtgcttcgcatggtggatggagga
ggcaggcaccaggtacagtttctgttccccatcaccttagtgcctgtggatgaccagcca
cctgttctcaatgccaacacggggctgacactggcagagggtgaaacagtgcccatcctg
cccctttccctgagtgcaactgacatggattcagatgattctctgctgctttttgtgctg
gagtcacccttcttaactacggggcatctgcttctccgccaaactcaccctccccatgag
aagcaggaacttctcagaggcctttggaggaaggagggggcattttatgagcgaacagtg
acagagtggcagcagcaggacataacagagggcaggctgttctatagacactctgggccc
catagtcctgggccagtcacagaccagttcacatttagagtccaggataaccatgaccct
cctaatcagtccgggctacagcggtttgtgattcgtatccatcctgtggatcgcctccct
ccggagctgggcagtggctgtccccttcgtatggtggtacaggaatcccagctcacacca
ctgaggaagaagtggctgcgctacactgacctggacacagatgaccgagaactacgttac
acagtgactcagccccccacagacacagacgaaaatcacctgccagccccactgggtacc
ttggtcttgactgacaacccctcagtcgtggtgacccattttacccaagcccagatcaac
catcataaaattgcttacagacccccgggtcaagaactgggcgtggctactcgagtggcc
cagttccagttccaggtggaagaccgagctgggaatgtggctccaggtacctttaccctt
tacttgcatcccgtggacaaccagccacctgagatcctcaacaccggcttcactattcag
gagaagggtcaccacatcctgagtgagacagagttgcacgtgaatgatgtagacactgat
gttgcccatatctctttcactctcactcaggcacccaaacatggccacatgagagtgtct
ggacagatcctgcatgtagggggtctcttccacttggaggacataaaacagggccgagtt
tcctatgcccataatggggacaagtccctgactgatagctgctccttggaagtcagtgac
agacatcatgtggtgcccatcactctcagagtaaatgtccggccagtggatgatgaagtg
cccatactgagccatcctactggcactctggagtcctatctagatgtcttagaaaatggg
gctactgaaatcactgccaatgttattaaggggaccaatgaggaaactgatgacttgatg
ttgactttcctcttggaagatccacctttgtatggggaaatcttggtcaatggcattcca
gcagagcagtttactcaaagggacatcttggagggctctgttgtatatacccacaccagt
ggtgagataggcctattgcctaaagcggattcttttaacctgagtctgtcagatatgtct
caagaatggagaattggtggcaatactatccaaggagttactatatgggtgaccatcctg
cctgttgatagccaggccccagaaatctttgtaggtgaacagttgatagtaatggaaggt
gataaaagtgttataacatcagtgcatataagtgctgaagatgtcgactccctgaatgat
gacatcttgtgcactatagttattcagcctacttcaggttatgttgaaaacatttctcca
gcaccaggctctgagaaatcaagagcagggattgccataagtgctttcaacttgaaagat
ctcaggcagggccacataaactatgtccagagtgtccataaaggggtggaacctgtggag
gaccgatttgtatttcgttgttctgatggcattaacttttcagagagacagttcttcccc
attgtaatcattcccaccaatgatgaacagccagagatgtttatgagagaatttatggtg
atggaaggcatgagtctggtaattgatacacccattctcaatgctgctgatgctgatgtt
cccctggatgatttaactttcactattacccaattccccactcatggtcacatcatgaat
cagctgataaatggcacggttttggtcgaaagcttcaccttggatcagatcatagagagt
tccagcattatttatgagcatgatgactccgagacccaggaagacagttttgtgattaaa
ctaacagatgggaagcactctgtggaaaagacggtcctcattatagttatccctgttgat
gatgagacgcccagaatgactatcaataatggactagaaatagaaattggggataccaag
attatcaacaacaaaatattaatggcaacagatttagattcagaagacaaatctttggtt
tatattattcgttatgggccaggacatggcttattacagagacgaaaacctactggtgcc
tttgaaaatatcacactgggcatgaattttacccaggatgaagtagacagaaacttaatt
cagtatgtccatttggggcaagagggcattcgggacctaattaaatttgatgtgactgat
ggaataaatcccctcatagatcgttacttttatgtgtccatcgggagcattgacattgtc
ttccctgatgtgataagtaagggagtgtccttgaaagaaggtggcaaagtcactcttaca
acagacctactaagcactagtgacttgaacagtcctgatgaaaacttggtttttaccatc
accagggctcccatgcgaggtcacctggaatgcacggatcagcctggtgtgtccatcacg
tctttcactcagctgcaactggctggaaacaaaatctactacatccacacagctgatgat
gaagtgaaaatggacagttttgagtttcaagtcaccgatggacgtaaccctgtctttcgg
acattccgtatctccattagcgatgtggacaataaaaagccagtggtcaccatccacaag
ctggttgtcagtgaaagtgaaaacaagctgattactccttttgagctcactgtcgaagac
agagatactcctgacaagctcctgaaattcactatcacccaggtgcctattcatggccat
ctcctattcaacaataccagacctgtcatggtttttaccaagcaagacttgaatgaaaac
ttaatcagctacaaacatgatggcactgagtcaagtgaagatagcttctccttcacagtg
actgatggcacccatacagacttctatgtttttcctgatacggtgtttgaaacaaggaga
ccccaagtgatgaagatccaggtcttggctgttgacaacagtgtcccccaaatcgcagtg
aataagggggcctctacacttcgcactctagccactggccacttggggttcatgatcaca
agcaaaatattgaaagtggaggacagagacagcttacacatttctcttagatttatcgtg
acagaggcccctcaacatggatatcttctcaacctggacaaaggcaaccacagcatcact
cagttcacacaagctgacattgatgacatgaaaatatgctatgtcttaagagaaggggct
aatgccacaagtgatatgttctattttgcagttgaagatggtggtggaaacaagttaacg
taccagaattttcgtctgaattgggcatggatctcctttgaaaaggaatattacctggtc
aatgaggactccaaatttctagatgttgttcttaaacgtagaggttacttgggagaaact
tcttttataagtattggcacaagagacagaactgcagaaaaagacaaagacttcaagggc
aaagcacagaaacaagtgcagttcaacccaggccagaccagggccacatggcgagtgcgg
atcctgagtgatggggagcatgagcagtctgaaacctttcaggtggtactctcagagccc
gtgctggctgccttggaattccccacagtcgccactgttgagatcgttgatccaggagat
gagccaactgtgtttattccccagtccaaatactccgttgaagaagatgttggtgagctg
ttcattcccatcaggaggagcggagatgtgagccaggagttgatggtggtctgttatacc
caacaaggaacagcaactggaactgtgccgacttccgtgttgtcttactctgattacata
tccaggcctgaggaccacaccagtgttgtccgctttgacaaagatgaacgggagaaactg
tgtcggatagtcataattgatgactctttgtacgaggaggaggaaaccttccatgtcctt
ctgagcatgcccatggggggaagaatcggatcagagttcccaggggctcaagttacaatc
gttcctgacaaagatgatgaacccatcttttacttcggtgatgtggaatactctgtggat
gagagtgctggctatgtggaagtgcaggtgtggagaacgggcactgacctgtccaagtct
tctagtgtcacagtgaggtctcggaaaacagatcctccctctgcagatgctggaacagac
tatgtgggcatcagccgtaatttagattttgcacctggagtcaacatgcagcctgttcgt
gttgtcattctggatgaccttggacaaccagcgctggagggaattgagaaatttgaactg
gtgcttcgcatgcctatgaacgcagcccttggcgagcccagcaaagccacagtgtccata
aatgactctgtctccgatttgcctaagatgcaattcaaagaacgaatatatactggcagc
gaaagtgatgggcagatagttacaatgatccataggactggggatgtccagtacagatct
tcagtgagatgctacacccggcaggggtctgcacaggtgatgatggactttgaagaacgc
ccaaacactgatacctccatcatcacattcctccctggtgagacagaaaagccctgcatt
cttgagctgatggacgatgtgctctatgaggaggtagaggagctccgcctggtactcggc
actccacaaagcaactctccctttggggctgcagttggtgaacaaaatgaaactctcata
aggatccgagatgatgctgataagactgttattaaatttggagaaaccaaatttagtgtc
actgaacccaaagaacctggagagtcggtggttataagaattccagtgattcgccaagga
gacacttcaaaggtttccattgtgagagtccacaccaaggatggctcggccacctctgga
gaagactaccaccctgtgtcagaagaaattgagtttaaggaaggggaaacccagcacgtg
gttgaaatcgaagttacctttgacggggtgagagagatgagagaggccttcactgttcac
ctaaaacctgatgaaaatatgatagcagagatgcagttgacgaaagccattgtgtacata
gaagaaatgagcagcatggcagatgtcacttttccttctgtccctcaaattgtatccctg
ttgatgtatgacgacacttccaaagctaaggagagtgctgaacccatgtctggctatcct
gtcatctgtatcacagcttgcaaccccaaatattcagactacgataaaacaggctctatc
tgtgcaagtgagaacatcaatgacactttgacgcggtaccggtggctgattagtgcacct
gcgggccctgacggtgtgaccagccctatgagagaagtggacttcgacaccttttttacg
tcatccaagatggtcacactggactccatatactttcagcctggctcccgggtacagtgc
gcagctcgtgctgtgaacaccaatggggatgaaggcctggagctcatgagccctattgta
accatcagcagagaagaaggtctttgtcagccccgtgtacctggggttgttggagcagag
ccgttctcagctaaattgcgctacacaggccctgaggatgcagactacacaaaccttatc
aagctcactgtcacaatgccacacatagatggcatgctccccgtgatctccactagagag
ctttccaactttgagctcaccctcagccctgatggcacaagagttggaaaccacaagtgc
tccaacctcctggattatactgaagtgaagactcattatggtttcttgactgatgctacc
aaaaatccagaaataattggagagacatatccttaccagtacagcttgtccatcagaggt
tccactaccttgcgcttctaccggaacctgaacctagaggcctgtttatgggagttcgtt
agctactatgacatgtcagaactccttgctgactgtggtggcaccattggaacagatgga
caggtcctaaacctagtgcagtcctatgtgacccttcgagtccctctgtatgtttcctac
gtgttccattcccccgtgggggtaggaggctggcagcattttgacttgaagtcagagctt
cgtctaacttttgtgtacgacaccgccatcttgtggaatgatggaattggcagcccccca
gaggctgaacttcaaggttctctctatccaaccagcatgcgcatcggtgatgaggggcgc
ttggccgtgcacttcaagacagaggctcagttccatggcttatttgtgctgtcacatccc
gcatcctttacaagctcagtgatcatgtcagctgatcatccaggcctgacattttccctc
cgcctcataaggagtgaaccaacctataaccagccagtacagcagtggagctttgtctct
gactttgccgtacgtgactactcagggacctatactgtgaagctggtgccatgcactgcc
ccatcacatcaggaataccgcctgccagtcacctgcaaccccagagaacctgtcaccttt
gaccttgacatccgattccaacaggtcagtgatccagtggctgctgagtttagcttgaac
acccaaatgtacctgctctctaagaagagtctctggttgtctgatggatccatgggattc
gggcaagagagtgatgttgcttttgcagaaggtgatataatttatggtcgtgtcatggtg
gatcctgtccagaatctgggtgactccttttactgcagcattgagaaggtgtttctatgc
actggagctgatggctatgttcccaagtatagtccaatgaatgcagaatatggctgctta
gccgactctccttcactcttatatagatttaaaattgtggacaaagctcagccagagaca
caagcgaccagttttggaaatgtcctatttaatgccaaactagcagtggatgaccctgaa
gccattctcttagtgaatcagcctggatctgatggatttaaagtcgactcaacaccactc
tttcaggtcgctctaggccgagaatggtatatacatacgatctatacagtgagatcgaaa
gacaatgccaatcgaggtattggcaaaagaagtgtggagtaccattctctggtgagtcaa
ggaaagccccaatccaccaccaagagccggaagaagagagagatcaggagcacaccctca
ctggcatgggagattggtgctgaaaacagtcgaggaacaaacatccagcacattgccctg
gaccgcaccaagaggcagatcccccatgggagagcacctccagatggcatcctcccctgg
gagctcaacagccccagctctgcagtcagcctggtcactgtggtgggaggcaccacggta
gggttactcaccatctgcctcactgtcattgcagtgctgatgtgcaggggcaaggaaagt
ttcagggggaaggatgccccgaaaggctccagcagcagtgagcccatggtgcccccacag
agccatcacaatgacagctcagaagtttga

DBGET integrated database retrieval system