KEGG   Homo sapiens (human): 1592
Entry
1592              CDS       T01001                                 

Gene name
CYP26A1, CP26, CYP26, P450RAI, P450RAI1
Definition
(RefSeq) cytochrome P450 family 26 subfamily A member 1
  KO
K07437  cytochrome P450 family 26 subfamily A
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Drug target
Talarozole: D09385
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1592 (CYP26A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1592 (CYP26A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP26 family
   1592 (CYP26A1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1592
NCBI-ProteinID: NP_000774
OMIM: 602239
HGNC: 2603
Ensembl: ENSG00000095596
Vega: OTTHUMG00000018765
Pharos: O43174(Tclin)
UniProt: O43174
LinkDB
Position
10q23.33
AA seq 497 aa
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggggctcccggcgctgctggccagtgcgctctgcaccttcgtgctgccgctgctgctc
ttcctggctgcgatcaagctctgggacctgtactgcgtgagcggccgcgaccgcagttgt
gccctcccattgccccccgggactatgggcttccccttctttggggaaaccttgcagatg
gtactgcagcggaggaagttcctgcagatgaagcgcaggaaatacggcttcatctacaag
acgcatctgttcgggcggcccaccgtacgggtgatgggcgcggacaatgtgcggcgcatc
ttgctcggagagcaccggctggtgtcggtccactggccagcgtcggtgcgcaccattctg
ggatctggctgcctctctaacctgcacgactcctcgcacaagcagcgcaagaaggtgatt
atgcgggccttcagccgcgaggcactcgaatgctacgtgccggtgatcaccgaggaagtg
ggcagcagcctggagcagtggctgagctgcggcgagcgcggcctcctggtctaccccgag
gtgaagcgcctcatgttccgaatcgccatgcgcatcctactgggctgcgaaccccaactg
gcgggcgacggggactccgagcagcagcttgtggaggccttcgaggaaatgacccgcaat
ctcttctcgctgcccatcgacgtgcccttcagcgggctgtaccggggcatgaaggcgcgg
aacctcattcacgcgcgcatcgagcagaacattcgcgccaagatctgcgggctgcgggca
tccgaggcgggccagggctgcaaagacgcgctgcagctgttgatcgagcactcgtgggag
aggggagagcggctggacatgcaggcactaaagcaatcttcaaccgaactcctctttgga
ggacacgaaaccacggccagtgcagccacatctctgatcacttacctggggctctaccca
catgttctccagaaagtgcgagaagagctgaagagtaagggtttactttgcaagagcaat
caagacaacaagttggacatggaaattttggaacaacttaaatacatcgggtgtgttatt
aaggagacccttcgactgaatcccccagttccaggagggtttcgggttgctctgaagact
tttgaattaaatggataccagattcccaagggctggaatgttatctacagtatctgtgat
actcatgatgtggcagagatcttcaccaacaaggaagaatttaatcctgaccgattcatg
ctgcctcacccagaggatgcatccaggttcagcttcattccatttggaggaggccttagg
agctgtgtaggcaaagaatttgcaaaaattcttctcaaaatatttacagtggagctggcc
aggcattgtgactggcagcttctaaatggacctcctacaatgaaaaccagtcccaccgtg
tatcctgtggacaatctccctgcaagattcacccatttccatggggaaatctga

KEGG   Homo sapiens (human): 340665
Entry
340665            CDS       T01001                                 

Gene name
CYP26C1, FFDD4
Definition
(RefSeq) cytochrome P450 family 26 subfamily C member 1
  KO
K12665  cytochrome P450 family 26 subfamily C
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Disease
H02083  Focal facial dermal dysplasia
Drug target
Talarozole: D09385
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    340665 (CYP26C1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    340665 (CYP26C1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP26 family
   340665 (CYP26C1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 340665
NCBI-ProteinID: NP_899230
OMIM: 608428
HGNC: 20577
Ensembl: ENSG00000187553
Vega: OTTHUMG00000018766
Pharos: Q6V0L0(Tbio)
UniProt: Q6V0L0
LinkDB
Position
10q23.33
AA seq 522 aa
MFPWGLSCLSVLGAAGTALLCAGLLLSLAQHLWTLRWMLSRDRASTLPLPKGSMGWPFFG
ETLHWLVQGSRFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQS
AHILLGSHTLLGAVGEPHRRRRKVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVS
VYDASKALTFRMAARILLGLRLDEAQCATLARTFEQLVENLFSLPLDVPFSGLRKGIRAR
DQLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHEPSMQELKESAVELLFAAFFT
TASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPPDCGCEPDLSL
AALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAV
YRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTA
RWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgttcccttgggggctgagctgcctgtcagtgctgggggcggcgggcactgctctcctg
tgcgcgggcctgctgctcagcctggcccagcacctctggaccctccgctggatgctgagc
cgggaccgggcctccaccctgcctctgcccaagggctccatggggtggcccttcttcggc
gaaacgctgcactggttagttcagggctcgcgcttccacagttctcgccgagagcgctat
gggacagtgttcaagacgcacctgctgggcaggccagtgatccgcgtgagcggcgcggag
aacgtgcgcaccatcctgctgggcgagcaccgcctggtgcgcagccagtggccgcagagt
gcgcacatcctgctgggctcgcacacactgctaggtgcggtcggcgagccgcaccggcgg
cggcgcaaggtcctggcgcgcgtgttcagccgcgccgcgctggagcgctacgtgccgcgc
ctgcagggggcgctgcggcatgaggtgcgctcctggtgcgcggcgggcgggccggtctca
gtctacgacgcctccaaagcgctcaccttccgcatggccgcgcgcatcctgctggggttg
cggctggacgaggcgcagtgcgccacgctggcccggaccttcgagcagctcgtggagaac
ctcttctcactgcctctggacgttcccttcagtggcctacgcaagggcatccgggcaagg
gaccagctgcatcggcacctggagggggccatttctgagaagcttcacgaggacaaggct
gcagagccgggtgatgccctcgacctaatcattcacagtgcaagggagctgggccatgag
ccctccatgcaggagctgaaggagtcggctgtggagctcctcttcgccgccttcttcacc
acggccagtgccagcacctcgctcgtcctgctgctactgcagcatccggcggccatcgcc
aagattcgggaggagctggtggcgcaggggctggggcgcgcgtgcggctgcgcgcccggg
gccgctgggggcagcgaggggcccccgcccgactgcggctgcgagcccgacctcagcctc
gcggcgctgggccgtctgcgctacgtcgactgcgtggtcaaggaggtgctgcgcctcctg
ccgccagtgtccgggggctaccgcaccgccctgcgcaccttcgagctcgacggctaccag
atccccaagggctggagcgtgatgtatagcatccgggacacgcacgagacggctgcggtg
taccgcagccctcccgaaggcttcgatccagagcgcttcggcgcagcgcgcgaagattcc
cggggcgcctccagccgcttccattacatcccgttcggcggcggtgcgcgcagctgcctc
ggccaggagctggcgcaagccgtgctccagctgctagctgtggagctagtgcgcaccgcg
cgctgggaactggccacacccgccttccccgccatgcagacggtgcccatcgtgcaccca
gtggacgggctgcggctctttttccaccccctcacgccttcggttgcggggaatgggcta
tgcctctga

KEGG   Homo sapiens (human): 56603
Entry
56603             CDS       T01001                                 

Gene name
CYP26B1, CYP26A2, P450RAI-2, P450RAI2, RHFCA
Definition
(RefSeq) cytochrome P450 family 26 subfamily B member 1
  KO
K12664  cytochrome P450 family 26 subfamily B
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Drug target
Talarozole: D09385
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    56603 (CYP26B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    56603 (CYP26B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP26 family
   56603 (CYP26B1)
SSDB
Motif
Pfam: p450 Med25
Other DBs
NCBI-GeneID: 56603
NCBI-ProteinID: NP_063938
OMIM: 605207
HGNC: 20581
Ensembl: ENSG00000003137
Vega: OTTHUMG00000129756
Pharos: Q9NR63(Tbio)
UniProt: Q9NR63
LinkDB
Position
2p13.2
AA seq 512 aa
MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIG
ETGHWLLQGSGFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRS
TRMLLGPNTVSNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAIN
VYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQAR
QILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYAT
TASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKE
VMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVL
HPVDGLSVKFFGLDSNQNEILPETEAMLSATV
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgctctttgagggcttggatctggtgtcggcgctggccaccctcgccgcgtgcctggtg
tccgtgacgctgctgctggccgtgtcgcagcagctgtggcagctgcgctgggccgccact
cgcgacaagagctgcaagctgcccatccccaagggatccatgggcttcccgctcatcgga
gagaccggccactggctgctgcagggttctggcttccagtcgtcgcggagggagaagtat
ggcaacgtgttcaagacgcatttgttggggcggccgctgatacgcgtgaccggcgcggag
aacgtgcgcaagatcctcatgggcgagcaccacctcgtgagcaccgagtggcctcgcagc
acccgcatgttgctgggccccaacacggtgtccaattccattggcgacatccaccgcaac
aagcgcaaggtcttctccaagatcttcagccacgaggccctggagagttacctgcccaag
atccagctggtgatccaggacacactgcgcgcctggagcagccaccccgaggccatcaac
gtgtaccaggaggcgcagaagctgaccttccgcatggccatccgggtgctgctgggcttc
agcatccctgaggaggaccttgggcacctctttgaggtctaccagcagtttgtggacaat
gtcttctccctgcctgtcgacctgcccttcagtggctaccggcggggcattcaggctcgg
cagatcctgcagaaggggctggagaaggccatccgggagaagctgcagtgcacacagggc
aaggactacttggacgccctggacctcctcattgagagcagcaaggagcacgggaaggag
atgaccatgcaggagctgaaggacgggaccctggagctgatctttgcggcctatgccacc
acggccagcgccagcacctcactcatcatgcagctgctgaagcaccccactgtgctggag
aagctgcgggatgagctgcgggctcatggcatcctgcacagtggcggctgcccctgcgag
ggcacactgcgcctggacacgctcagtgggctgcgctacctggactgcgtcatcaaggag
gtcatgcgcctgttcacgcccatttccggcggctaccgcactgtgctgcagaccttcgag
cttgatggtttccagatccccaaaggctggagtgtcatgtatagcatccgggacacccat
gacacagcgcccgtgttcaaagacgtgaacgtgttcgaccccgatcgcttcagccaggcg
cggagcgaggacaaggatggccgcttccattacctcccgttcggtggcggtgtccggacc
tgcctgggcaagcacctggccaagctgttcctgaaggtgctggcggtggagctggctagc
accagccgctttgagctggccacacggaccttcccccgcatcaccttggtccccgtcctg
caccccgtggatggcctcagcgtcaagttctttggcctggactccaaccagaacgagatc
ctgccggagacggaggccatgctgagcgccacagtctaa

DBGET integrated database retrieval system