KEGG   Homo sapiens (human): 160287Help
Entry
160287            CDS       T01001                                 

Gene name
LDHAL6A, LDH6A
Definition
(RefSeq) lactate dehydrogenase A like 6A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    160287 (LDHAL6A)
   00620 Pyruvate metabolism
    160287 (LDHAL6A)
   00640 Propanoate metabolism
    160287 (LDHAL6A)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    160287 (LDHAL6A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    160287 (LDHAL6A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    160287 (LDHAL6A)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    160287 (LDHAL6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    160287 (LDHAL6A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     160287 (LDHAL6A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   160287 (LDHAL6A)
  Exosomal proteins of breast milk
   160287 (LDHAL6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 UDPG_MGDP_dh_N ThiF Disaggr_assoc Mig-14
Motif
Other DBs
NCBI-GeneID: 160287
NCBI-ProteinID: NP_001137543
HGNC: 28335
Ensembl: ENSG00000166800
Vega: OTTHUMG00000167724
Pharos: Q6ZMR3(Tbio)
UniProt: Q6ZMR3
LinkDB All DBs
Position
11p15.1
AA seq 332 aa AA seqDB search
MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKG
ETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLM
IPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGI
HSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYE
MVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGI
TDLIKVKLTLEEEACLQKSAETLWEIQKELKL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaactatcaagagtgaacttattaagaatttcgcggaagaggaggccattcatcac
aataagatctccattgtaggaactggatcggttggtgtggcttgtgctatcagcatctta
ttaaaaggtttgagtgatgaacttgtccttgtggatgttgatgaaggcaaactgaagggt
gagacaatggatcttcaacatggcagcccttttatgaaaatgccaaatattgtctccagc
aaagattacctggtcactgcaaactccaatctagtgattatcacagcaggtgcacgccag
aaaaaaggagaaacacgccttgatttagtccagcgaaatgtatccatctttaaattaatg
attcccaatattacccagtacagtcctcactgcaaactgcttattgttactaatccagtg
gatatcttaacttatgtagcctggaagttgagtggatttcccaaaaaccgtgttattgga
agtggttgtaatctggactctgctcgttttcgttactttattgggcaaaggcttggcatc
cactctgaaagctgtcatgggctgatccttggagagcatggcgactcaagtgttcctgtg
tggagtggtgtgaacattgctggcgtccctctgaaggatctgaacccagatataggaact
gataaagatcctgagcagtgggaaaatgtccacaaaaaagtgatttccagtggctatgag
atggtcaaaatgaaaggttatacttcttggggcattagcctatctgtagctgatttaaca
gaaagtattttgaagaatcttaggagagtgcatccagtttctaccctaagtaagggcctc
tatggaataaatgaagacatattccttagtgtcccatgtatcctgggagagaatggtatc
acagacctcataaaagtaaaactgactcttgaagaggaggcctgcttgcaaaagagtgca
gaaacactttgggaaattcagaaggagctcaagctttaa

DBGET integrated database retrieval system