KEGG   Homo sapiens (human): 160287
Entry
160287            CDS       T01001                                 

Gene name
LDHAL6A, LDH6A
Definition
(RefSeq) lactate dehydrogenase A like 6A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    160287 (LDHAL6A)
   00620 Pyruvate metabolism
    160287 (LDHAL6A)
   00640 Propanoate metabolism
    160287 (LDHAL6A)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    160287 (LDHAL6A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    160287 (LDHAL6A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    160287 (LDHAL6A)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    160287 (LDHAL6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    160287 (LDHAL6A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     160287 (LDHAL6A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   160287 (LDHAL6A)
  Exosomal proteins of breast milk
   160287 (LDHAL6A)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 UDPG_MGDP_dh_N ThiF Disaggr_assoc Mig-14
Other DBs
NCBI-GeneID: 160287
NCBI-ProteinID: NP_001137543
OMIM: 618928
HGNC: 28335
Ensembl: ENSG00000166800
Vega: OTTHUMG00000167724
Pharos: Q6ZMR3(Tbio)
UniProt: Q6ZMR3
LinkDB
Position
11p15.1
AA seq 332 aa
MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKG
ETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLM
IPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGI
HSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYE
MVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGI
TDLIKVKLTLEEEACLQKSAETLWEIQKELKL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcaactatcaagagtgaacttattaagaatttcgcggaagaggaggccattcatcac
aataagatctccattgtaggaactggatcggttggtgtggcttgtgctatcagcatctta
ttaaaaggtttgagtgatgaacttgtccttgtggatgttgatgaaggcaaactgaagggt
gagacaatggatcttcaacatggcagcccttttatgaaaatgccaaatattgtctccagc
aaagattacctggtcactgcaaactccaatctagtgattatcacagcaggtgcacgccag
aaaaaaggagaaacacgccttgatttagtccagcgaaatgtatccatctttaaattaatg
attcccaatattacccagtacagtcctcactgcaaactgcttattgttactaatccagtg
gatatcttaacttatgtagcctggaagttgagtggatttcccaaaaaccgtgttattgga
agtggttgtaatctggactctgctcgttttcgttactttattgggcaaaggcttggcatc
cactctgaaagctgtcatgggctgatccttggagagcatggcgactcaagtgttcctgtg
tggagtggtgtgaacattgctggcgtccctctgaaggatctgaacccagatataggaact
gataaagatcctgagcagtgggaaaatgtccacaaaaaagtgatttccagtggctatgag
atggtcaaaatgaaaggttatacttcttggggcattagcctatctgtagctgatttaaca
gaaagtattttgaagaatcttaggagagtgcatccagtttctaccctaagtaagggcctc
tatggaataaatgaagacatattccttagtgtcccatgtatcctgggagagaatggtatc
acagacctcataaaagtaaaactgactcttgaagaggaggcctgcttgcaaaagagtgca
gaaacactttgggaaattcagaaggagctcaagctttaa

KEGG   Homo sapiens (human): 3939
Entry
3939              CDS       T01001                                 

Gene name
LDHA, GSD11, HEL-S-133P, LDHM, PIG19
Definition
(RefSeq) lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01946  Glycogen storage disease type XI
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3939 (LDHA)
   00620 Pyruvate metabolism
    3939 (LDHA)
   00640 Propanoate metabolism
    3939 (LDHA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3939 (LDHA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    3939 (LDHA)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3939 (LDHA)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3939 (LDHA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3939 (LDHA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3939 (LDHA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3939 (LDHA)
  Exosomal proteins of breast milk
   3939 (LDHA)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 Pyr_redox_2 Glyco_hydro_4C
Other DBs
NCBI-GeneID: 3939
NCBI-ProteinID: NP_005557
OMIM: 150000
HGNC: 6535
Ensembl: ENSG00000134333
Vega: OTTHUMG00000167721
Pharos: P00338(Tchem)
UniProt: P00338 V9HWB9
LinkDB
Structure
PDB: 

Position
11p15.1
AA seq 332 aa
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcaactctaaaggatcagctgatttataatcttctaaaggaagaacagaccccccag
aataagattacagttgttggggttggtgctgttggcatggcctgtgccatcagtatctta
atgaaggacttggcagatgaacttgctcttgttgatgtcatcgaagacaaattgaaggga
gagatgatggatctccaacatggcagccttttccttagaacaccaaagattgtctctggc
aaagactataatgtaactgcaaactccaagctggtcattatcacggctggggcacgtcag
caagagggagaaagccgtcttaatttggtccagcgtaacgtgaacatctttaaattcatc
attcctaatgttgtaaaatacagcccgaactgcaagttgcttattgtttcaaatccagtg
gatatcttgacctacgtggcttggaagataagtggttttcccaaaaaccgtgttattgga
agcggttgcaatctggattcagcccgattccgttacctaatgggggaaaggctgggagtt
cacccattaagctgtcatgggtgggtccttggggaacatggagattccagtgtgcctgta
tggagtggaatgaatgttgctggtgtctctctgaagactctgcacccagatttagggact
gataaagataaggaacagtggaaagaggttcacaagcaggtggttgagagtgcttatgag
gtgatcaaactcaaaggctacacatcctgggctattggactctctgtagcagatttggca
gagagtataatgaagaatcttaggcgggtgcacccagtttccaccatgattaagggtctt
tacggaataaaggatgatgtcttccttagtgttccttgcattttgggacagaatggaatc
tcagaccttgtgaaggtgactctgacttctgaggaagaggcccgtttgaagaagagtgca
gatacactttgggggatccaaaaggagctgcaattttaa

KEGG   Homo sapiens (human): 3945
Entry
3945              CDS       T01001                                 

Gene name
LDHB, HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
Definition
(RefSeq) lactate dehydrogenase B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3945 (LDHB)
   00620 Pyruvate metabolism
    3945 (LDHB)
   00640 Propanoate metabolism
    3945 (LDHB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3945 (LDHB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    3945 (LDHB)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3945 (LDHB)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3945 (LDHB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3945 (LDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3945 (LDHB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3945 (LDHB)
  Exosomal proteins of breast milk
   3945 (LDHB)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Other DBs
NCBI-GeneID: 3945
NCBI-ProteinID: NP_001167568
OMIM: 150100
HGNC: 6541
Ensembl: ENSG00000111716
Vega: OTTHUMG00000133760
Pharos: P07195(Tchem)
UniProt: P07195 Q5U077
LinkDB
Structure
PDB: 
1I0Z 1T2F

Position
12p12.1
AA seq 334 aa
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcaactcttaaggaaaaactcattgcaccagttgcggaagaagaggcaacagttcca
aacaataagatcactgtagtgggtgttggacaagttggtatggcgtgtgctatcagcatt
ctgggaaagtctctggctgatgaacttgctcttgtggatgttttggaagataagcttaaa
ggagaaatgatggatctgcagcatgggagcttatttcttcagacacctaaaattgtggca
gataaagattattctgtgactgccaattctaagattgtagtggtaactgcaggagtccgt
cagcaagaaggggagagtcggctcaatctggtgcagagaaatgttaatgtcttcaaattc
attattcctcagatcgtcaagtacagtcctgattgcatcataattgtggtttccaaccca
gtggacattcttacgtatgttacctggaaactaagtggattacccaaacaccgcgtgatt
ggaagtggatgtaatctggattctgctagatttcgctaccttatggctgaaaaacttggc
attcatcccagcagctgccatggatggattttgggggaacatggcgactcaagtgtggct
gtgtggagtggtgtgaatgtggcaggtgtttctctccaggaattgaatccagaaatggga
actgacaatgatagtgaaaattggaaggaagtgcataagatggtggttgaaagtgcctat
gaagtcatcaagctaaaaggatataccaactgggctattggattaagtgtggctgatctt
attgaatccatgttgaaaaatctatccaggattcatcccgtgtcaacaatggtaaagggg
atgtatggcattgagaatgaagtcttcctgagccttccatgtatcctcaatgcccgggga
ttaaccagcgttatcaaccagaagctaaaggatgatgaggttgctcagctcaagaaaagt
gcagataccctgtgggacatccagaaggacctaaaagacctgtga

KEGG   Homo sapiens (human): 3948
Entry
3948              CDS       T01001                                 

Gene name
LDHC, CT32, LDH3, LDHX
Definition
(RefSeq) lactate dehydrogenase C
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3948 (LDHC)
   00620 Pyruvate metabolism
    3948 (LDHC)
   00640 Propanoate metabolism
    3948 (LDHC)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    3948 (LDHC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    3948 (LDHC)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3948 (LDHC)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3948 (LDHC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3948 (LDHC)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     3948 (LDHC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3948 (LDHC)
  Exosomal proteins of breast milk
   3948 (LDHC)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Other DBs
NCBI-GeneID: 3948
NCBI-ProteinID: NP_002292
OMIM: 150150
HGNC: 6544
Ensembl: ENSG00000166796
Vega: OTTHUMG00000167722
Pharos: P07864(Tbio)
UniProt: P07864 A0A140VKA7
LinkDB
Position
11p15.1
AA seq 332 aa
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKG
EMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSI
IPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGV
HPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYE
IIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV
SDVVKINLNSEEEALFKKSAETLWNIQKDLIF
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtcaactgtcaaggagcagctaattgagaagctaattgaggatgatgaaaactcccag
tgtaaaattactattgttggaactggtgccgtaggcatggcttgtgctattagtatctta
ctgaaggatttggctgatgaacttgcccttgttgatgttgcattggacaaactgaaggga
gaaatgatggatcttcagcatggcagtcttttctttagtacttcaaagattacttctgga
aaagattacagtgtatctgcaaactccagaatagttattgtcacagcaggtgcaaggcag
caggagggagaaactcgccttgccctggtccaacgtaatgtggctataatgaaatcaatc
attcctgccatagtccattatagtcctgattgtaaaattcttgttgtttcaaatccagtg
gatattttgacatatatagtctggaagataagtggcttacctgtaactcgtgtaattgga
agtggttgtaatctagactctgcccgtttccgttacctaattggagaaaagttgggtgtc
caccccacaagctgccatggttggattattggagaacatggtgattctagtgtgccctta
tggagtggggtgaatgttgctggtgttgctctgaagactctggaccctaaattaggaacg
gattcagataaggaacactggaaaaatatccataaacaagttattcaaagtgcctatgaa
attatcaagctgaaggggtatacctcttgggctattggactgtctgtgatggatttggta
ggatccattttgaaaaatcttaggagagtgcacccagtttccaccatggttaagggatta
tatggaataaaagaagaactctttctcagtatcccttgtgtcttggggcggaatggtgtc
tcagatgttgtgaaaattaacttgaattctgaggaggaggcccttttcaagaagagtgca
gaaacactttggaatattcaaaaggatctaatattttaa

KEGG   Homo sapiens (human): 92483
Entry
92483             CDS       T01001                                 

Gene name
LDHAL6B, LDH6B, LDHAL6, LDHL
Definition
(RefSeq) lactate dehydrogenase A like 6B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    92483 (LDHAL6B)
   00620 Pyruvate metabolism
    92483 (LDHAL6B)
   00640 Propanoate metabolism
    92483 (LDHAL6B)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    92483 (LDHAL6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    92483 (LDHAL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    92483 (LDHAL6B)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    92483 (LDHAL6B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92483 (LDHAL6B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     92483 (LDHAL6B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   92483 (LDHAL6B)
  Exosomal proteins of breast milk
   92483 (LDHAL6B)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 UDPG_MGDP_dh_N ThiF
Other DBs
NCBI-GeneID: 92483
NCBI-ProteinID: NP_149972
HGNC: 21481
Ensembl: ENSG00000171989
Vega: OTTHUMG00000132714
Pharos: Q9BYZ2(Tbio)
UniProt: Q9BYZ2 A0A140VJM9
LinkDB
Position
15q22.2
AA seq 381 aa
MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER
FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPF
TKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHC
KLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILG
EHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA
IGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPE
EEAHLKKSAKTLWEIQNKLKL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagttggactgtgcctgttgtgcgggccagccagagagtgagctcggtgggagcgaat
ttcctatgcctggggatggccctgtgtccgcgtcaagcaacgcgcatcccgctcaacggc
acctggctcttcacccccgtgagcaagatggcgactgtgaagagtgagcttattgagcgt
ttcacttccgagaagcccgttcatcacagtaaggtctccatcataggaactggatcggtg
ggcatggcctgcgctatcagcatcttattaaaaggcttgagtgatgaacttgcccttgtg
gatcttgatgaagacaaactgaagggtgagacgatggatcttcaacatggcagccctttc
acgaaaatgccaaatattgtttgtagcaaagattactttgtcacagcaaactccaaccta
gtgattatcacagcaggtgcacgccaagaaaagggagaaacgcgccttaatttagtccag
cgaaatgtggccatcttcaagttaatgatttccagtattgtccagtacagcccccactgc
aaactgattattgtttccaatccagtggatatcttaacttatgtagcttggaagttgagt
gcatttcccaaaaaccgtattattggaagcggctgtaatctggatactgctcgttttcgt
ttcttgattggacaaaagcttggtatccattctgaaagctgccatggatggatcctcgga
gagcatggagactcaagtgttcctgtgtggagtggagtgaacatagctggtgtccctttg
aaggatctgaactctgatataggaactgataaagatcctgagcaatggaaaaatgtccac
aaagaagtgactgcaactgcctatgagattattaaaatgaaaggttatacttcttgggcc
attggcctatctgtggccgatttaacagaaagtattttgaagaatcttaggagaatacat
ccagtttccaccataattaagggcctctatggaatagatgaagaagtattcctcagtatt
ccttgtatcctgggagagaacggtattaccaaccttataaagataaagctgacccctgaa
gaagaggcccatctgaaaaaaagtgcaaaaacactctgggaaattcagaataagcttaag
ctttaa

DBGET integrated database retrieval system