KEGG   Homo sapiens (human): 1612Help
Entry
1612              CDS       T01001                                 

Gene name
DAPK1, DAPK, ROCO3
Definition
(RefSeq) death associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05200  Pathways in cancer
hsa05219  Bladder cancer
Disease
H00022  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    1612 (DAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1612 (DAPK1)
  09162 Cancer: specific types
   05219 Bladder cancer
    1612 (DAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1612 (DAPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1612 (DAPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   1612 (DAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Ank_2 Ank_4 Ank_5 Pkinase_Tyr Ank_3 Ank Death COR Kdo RIO1 O_Spanin_T7 AAA_23 APH Choline_kinase ABC_tran DUF3847 AAA_16
Motif
Other DBs
NCBI-GeneID: 1612
NCBI-ProteinID: NP_001275658
OMIM: 600831
HGNC: 2674
Ensembl: ENSG00000196730
Vega: OTTHUMG00000020150
Pharos: P53355(Tchem)
UniProt: P53355
LinkDB All DBs
Structure
PDB: 

Position
9q21.33
AA seq 1430 aa AA seqDB search
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgttcaggcaggaaaacgtggatgattactacgacaccggcgaggaacttggc
agtggacagtttgcggttgtgaagaaatgccgtgagaaaagcaccggcctccagtatgcc
gccaaattcatcaagaaaaggaggactaagtccagccggcggggtgtgagccgcgaggac
atcgagcgggaggtcagcatcctgaaggagatccagcaccccaatgtcatcaccctgcac
gaggtctatgagaacaagacggacgtcatcctgatcttggaactcgttgcaggtggcgag
ctgtttgacttcttagctgaaaaggaatctttaactgaagaggaagcaactgaatttctc
aaacaaattcttaatggtgtttactacctgcactcccttcaaatcgcccactttgatctt
aagcctgagaacataatgcttttggatagaaatgtccccaaacctcggatcaagatcatt
gactttgggttggcccataaaattgactttggaaatgaatttaaaaacatatttgggact
ccagagtttgtcgctcctgagatagtcaactatgaacctcttggtcttgaggcagatatg
tggagtatcggggtaataacctatatcctcctaagtggggcctccccatttcttggagac
actaagcaagaaacgttagcaaatgtatccgctgtcaactacgaatttgaggatgaatac
ttcagtaataccagtgccctagccaaagatttcataagaagacttctggtcaaggatcca
aagaagagaatgacaattcaagatagtttgcagcatccctggatcaagcctaaagataca
caacaggcacttagtagaaaagcatcagcagtaaacatggagaaattcaagaagtttgca
gcccggaaaaaatggaaacaatccgttcgcttgatatcactgtgccaaagattatccagg
tcattcctgtccagaagtaacatgagtgttgccagaagcgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcatccatgccatcaacgatgacaatgtcccaggcctg
cagcaccttctgggctcattatccaactatgatgttaaccaacccaacaagcacgggaca
cctccattactcattgctgctggctgtgggaatattcaaatactacagttgctcattaaa
agaggctcgagaatcgatgtccaggataagggcgggtccaatgccgtctactgggctgct
cggcatggccacgtcgataccttgaaatttctcagtgagaacaaatgccctttggatgtg
aaagacaagtctggagagatggccctccacgtggcagctcgctatggccatgctgacgtg
gctcagttactgtgcagcttcggctcaaatcccaatatccaggacaaggaagaagaaacc
cccctgcactgtgctgcttggcacggctattactctgtggccaaagccctttgtgaagcc
ggctgtaacgtgaacatcaagaaccgagaaggagagacgcccctcctgacagcctctgcc
aggggctaccacgacatcgtggagtgtctggccgaacatggagccgaccttaatgcttgc
gacaaggacggacacattgcccttcatctggctgtaagacggtgtcagatggaggtaatc
aagactctcctcagccaagggtgtttcgtcgattatcaagacaggcacggcaatactccc
ctccatgtggcatgtaaagatggcaacatgcctatcgtggtggccctctgtgaagcaaac
tgcaatttggacatctccaacaagtatgggcgaacgcctctgcaccttgcggccaacaac
ggaatcctagacgtggtccggtatctctgtctgatgggagccagcgttgaggcgctgacc
acggacggaaagacggcagaagatcttgctagatcggaacagcacgagcacgtagcaggt
ctccttgcaagacttcgaaaggatacgcaccgaggactcttcatccagcagctccgaccc
acacagaacctgcagccaagaattaagctcaagctgtttggccactcgggatccgggaaa
accacccttgtagaatctctcaagtgtgggctgctgaggagctttttcagaaggcgtcgg
cccagactgtcttccaccaactccagcaggttcccaccttcacccctggcttctaagccc
acagtctcagtgagcatcaacaacctgtacccaggctgcgagaacgtgagtgtgaggagc
cgcagcatgatgttcgagccgggtcttaccaaagggatgctggaggtgtttgtggccccg
acccaccacccgcactgctcggccgatgaccagtccaccaaggccatcgacatccagaac
gcttatttgaatggagttggcgatttcagcgtgtgggagttctctggaaatcctgtgtat
ttctgctgttatgactattttgctgcaaatgatcccacgtcaatccatgttgttgtcttt
agtctagaagagccctatgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtcccttgtcccagttgaagaacccatagccttcggtggcaagctgaagaacccactc
caagttgtcctggtggccacccacgctgacatcatgaatgttcctcgaccggctggaggc
gagtttggatatgacaaagacacatcgttgctgaaagagattaggaacaggtttggaaat
gatcttcacatttcaaataagctgtttgttctggatgctggggcttctgggtcaaaggac
atgaaggtacttcgaaatcatctgcaagaaatacgaagccagattgtttcggtctgtcct
cccatgactcacctgtgtgagaaaatcatctccacgctgccttcctggaggaagctcaat
ggacccaaccagctgatgtcgctgcagcagtttgtgtacgacgtgcaggaccagctgaac
cccctggccagcgaggaggacctcaggcgcattgctcagcagctccacagcacaggcgag
atcaacatcatgcaaagtgaaacagttcaggacgtgctgctcctggacccccgctggctc
tgcacaaacgtcctggggaagttgctgtccgtggagaccccacgggcgctgcaccactac
cggggccgctacaccgtggaggacatccagcgcctggtgcccgacagcgacgtggaggag
ctgctgcagatcctcgatgccatggacatctgcgcccgggacctgagcagcgggaccatg
gtggacgtcccagccctgatcaagacagacaacctgcaccgctcctgggctgatgaggag
gacgaggtgatggtgtatggtggcgtgcgcatcgtgcccgtggaacacctcacccccttc
ccatgtggcatctttcacaaggtccaggtgaacctgtgccggtggatccaccagcaaagc
acagagggcgacgcggacatccgcctgtgggtgaatggctgcaagctggccaaccgtggg
gccgagctgctggtgctgctggtcaaccacggccagggcattgaggtccaggtccgcggc
ctggagacggagaagatcaagtgctgcctgctgctggactcggtgtgcagcaccattgag
aacgtcatggccaccacgctgccagggctcctgaccgtgaagcattacctgagcccccag
cagctgcgggagcaccatgagcccgtcatgatctaccagccacgggacttcttccgggca
cagactctgaaggaaacctcactgaccaacaccatgggggggtacaaggaaagcttcagc
agcatcatgtgcttcgggtgtcacgacgtctactcacaggccagcctcggcatggacatc
catgcatcagacctgaacctcctcactcggaggaaactgagtcgcctgctggacccgccc
gaccccctggggaaggactggtgccttctcgccatgaacttaggcctccctgacctcgtg
gcaaagtacaacaccagtaacggggctcccaaggatttcctccccagccccctccacgcc
ctgctgcgggaatggaccacctaccctgagagcacagtgggcaccctcatgtccaaactg
agggagctgggtcgccgggatgccgcagactttttgctgaaggcatcctctgtgttcaaa
atcaacctggatggcaatggccaggaggcctatgcctcgagctgcaacagcggcacctct
tacaattccattagctctgttgtatcccggtga

KEGG   Homo sapiens (human): 1613Help
Entry
1613              CDS       T01001                                 

Gene name
DAPK3, DLK, ZIP, ZIPK
Definition
(RefSeq) death associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05200  Pathways in cancer
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    1613 (DAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1613 (DAPK3)
  09162 Cancer: specific types
   05219 Bladder cancer
    1613 (DAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1613 (DAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1613 (DAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   1613 (DAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo RIO1 Choline_kinase Kinase-like DUF3847 APH
Motif
Other DBs
NCBI-GeneID: 1613
NCBI-ProteinID: NP_001339
OMIM: 603289
HGNC: 2676
Ensembl: ENSG00000167657
Vega: OTTHUMG00000181825
Pharos: O43293(Tchem)
UniProt: O43293 B3KNJ3
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 454 aa AA seqDB search
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgttcaggcaggaggacgtggaggaccattatgagatgggggaggagctgggc
agcggccagtttgcgatcgtgcggaagtgccggcagaagggcacgggcaaggagtacgca
gccaagttcatcaagaagcgccgcctgtcatccagccggcgtggggtgagccgggaggag
atcgagcgggaggtgaacatcctgcgggagatccggcaccccaacatcatcaccctgcac
gacatcttcgagaacaagacggacgtggtcctcatcctggagctggtctctggcggggag
ctctttgacttcctggcggagaaggagtcgctgacggaggacgaggccacccagttcctc
aagcagatcctggacggcgttcactacctgcactctaagcgcatcgcacactttgacctg
aagccggaaaacatcatgctgctggacaagaacgtgcccaacccacgaatcaagctcatc
gacttcggcatcgcgcacaagatcgaggcggggaacgagttcaagaacatcttcggcacc
ccggagtttgtggccccagagattgtgaactatgagccgctgggcctggaggcggacatg
tggagcatcggtgtcatcacctatatcctcctgagcggtgcatccccgttcctgggcgag
accaagcaggagacgctcaccaacatctcagccgtgaactacgacttcgacgaggagtac
ttcagcaacaccagcgagctggccaaggacttcattcgccggctgctcgtcaaagatccc
aagcggagaatgaccattgcccagagcctggaacattcctggattaaggcgatccggcgg
cggaacgtgcgtggtgaggacagcggccgcaagcccgagcggcggcgcctgaagaccacg
cgtctgaaggagtacaccatcaagtcgcactccagcttgccgcccaacaacagctacgcc
gacttcgagcgcttctccaaggtgctggaggaggcggcggccgccgaggagggcctgcgc
gagctgcagcgcagccggcggctctgccacgaggacgtggaggcgctggccgccatctac
gaggagaaggaggcctggtaccgcgaggagagcgacagcctgggccaggacctgcggagg
ctacggcaggagctgctcaagaccgaggcgctcaagcggcaggcgcaggaggaggccaag
ggcgcgctgctggggaccagcggcctcaagcgccgcttcagccgcctggagaaccgctac
gaggcgctggccaagcaagtagcctccgagatgcgcttcgtgcaggacctcgtgcgcgcc
ctggagcaggagaagctgcagggcgtggagtgcgggctgcgctag

KEGG   Homo sapiens (human): 23604Help
Entry
23604             CDS       T01001                                 

Gene name
DAPK2, DRP-1, DRP1
Definition
(RefSeq) death associated protein kinase 2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05200  Pathways in cancer
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    23604 (DAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23604 (DAPK2)
  09162 Cancer: specific types
   05219 Bladder cancer
    23604 (DAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23604 (DAPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23604 (DAPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   23604 (DAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kdo Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 23604
NCBI-ProteinID: NP_055141
OMIM: 616567
HGNC: 2675
Ensembl: ENSG00000035664
Vega: OTTHUMG00000132947
Pharos: Q9UIK4(Tchem)
UniProt: Q9UIK4 A0A024R603
LinkDB All DBs
Structure
PDB: 

Position
15q22.31
AA seq 370 aa AA seqDB search
MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
LHPRRRSSTS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcctcaatgaggagtccaaacatggagccattcaagcagcagaaggtggag
gacttttatgacatcggagaggagctggggagtggccagtttgccatcgtgaagaagtgc
cgggagaagagcacggggcttgagtatgcagccaagttcatcaagaagcggcagagccgg
gcgagccggcgcggtgtgagccgggaggagatcgagcgggaggtgagcatcctgcggcag
gtgctgcaccacaatgtcatcacgctgcacgacgtctatgagaaccgcaccgacgtggtg
ctcatccttgagctagtgtctggaggagagctcttcgatttcctggcccagaaggagtca
ctgagtgaggaggaggccaccagcttcattaagcagatcctggatggggtgaactacctt
cacacaaagaaaattgctcactttgatctcaagccagaaaacattatgttgttagacaag
aatattcccattccacacatcaagctgattgactttggtctggctcacgaaatagaagat
ggagttgaatttaagaatatttttgggacgccggaatttgttgctccagaaattgtgaac
tacgagcccctgggtctggaggctgacatgtggagcataggcgtcatcacctacatcctc
ttaagtggagcatcccctttcctgggagacacgaagcaggaaacactggcaaatatcaca
gcagtgagttacgactttgatgaggaattcttcagccagacgagcgagctggccaaggac
tttattcggaagcttctggttaaagagacccggaaacggctcacaatccaagaggctctc
agacacccctggatcacgccggtggacaaccagcaagccatggtgcgcagggagtctgtg
gtcaatctggagaacttcaggaagcagtatgtccgcaggcggtggaagctttccttcagc
atcgtgtccctgtgcaaccacctcacccgctcgctgatgaagaaggtgcacctgaggccg
gatgaggacctgaggaactgtgagagtgacactgaggaggacatcgccaggaggaaagcc
ctccacccacggaggaggagcagcacctcctaa

DBGET integrated database retrieval system