KEGG   Homo sapiens (human): 1622
Entry
1622              CDS       T01001                                 

Gene name
DBI, ACBD1, ACBP, CCK-RP, EP
Definition
(RefSeq) diazepam binding inhibitor, acyl-CoA binding protein
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    1622 (DBI)
SSDB
Motif
Pfam: ACBP FERM_M JmjN
Other DBs
NCBI-GeneID: 1622
NCBI-ProteinID: NP_001073331
OMIM: 125950
HGNC: 2690
Ensembl: ENSG00000155368
Vega: OTTHUMG00000131403
Pharos: P07108(Tbio)
UniProt: P07108
LinkDB
Structure
PDB: 
2FJ9 2CB8

Position
2q14.2
AA seq 87 aa
MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWN
ELKGTSKEDAMKAYINKVEELKKKYGI
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtctcaggctgagtttgagaaagctgcagaggaggttaggcaccttaagaccaagcca
tcggatgaggagatgctgttcatctatggccactacaaacaagcaactgtgggcgacata
aatacagaacggcccgggatgttggacttcacgggcaaggccaagtgggatgcctggaat
gagctgaaagggacttccaaggaagatgccatgaaagcttacatcaacaaagtagaagag
ctaaagaaaaaatacgggatatga

DBGET integrated database retrieval system