KEGG   Homo sapiens (human): 162993Help
Entry
162993            CDS       T01001                                 

Gene name
ZNF846
Definition
(RefSeq) zinc finger protein 846
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162993 (ZNF846)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162993 (ZNF846)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    162993 (ZNF846)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz XPA_N zf-C2H2_11 Zn-ribbon_8 zinc_ribbon_15 zf-trcl zf-BED Rpr2 zf-met zf_Hakai zf_C2H2_ZHX
Motif
Other DBs
NCBI-GeneID: 162993
NCBI-ProteinID: NP_001071092
HGNC: 27260
Ensembl: ENSG00000196605
Vega: OTTHUMG00000180208
Pharos: Q147U1(Tdark)
UniProt: Q147U1
LinkDB All DBs
Position
19p13.2
AA seq 533 aa AA seqDB search
MDSSQHLVTFEDVAVDFTQEEWTLLDQAQRDLYRDVMLENYKNLIILAGSELFKRSLMSG
LEQMEELRTGVTGVLQELDLQLKTKGSPLLQDISAERSPNGVQLERSNTAEKLYDSNHSG
KVFNEHPFLMTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAFN
QFPNLTRQNKTHTQEKLCECKDCWRTFLNQSSLKLHIRSHNGDKHYVCKECGKAFSNSSH
LIGHGRIHSGEKPYVCKECGKAFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDH
TRIHSGKKPYVCMECGKAFTRSTGLILHMRIHTGEKPYECKECGKAFIHSSYLTKHVRIH
SGEKLYLCKACGKAFTRSSGLVLHMRTHTGEKPYECKECGKAFNNSSMLSQHVRIHTGEK
PYECKECGKAFTQSSGLSTHLRTHTGEKACECKECGKAFARSTNLNMHMRTHTGEKPYAC
KECGKAFRYSTYLNVHTRTHTGAKPYECKKCGKNFTQSSALAKHLRTKACEKT
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggattcttctcagcacttagtgacctttgaggatgtggctgtggactttacccaggag
gagtggactttgttggatcaagcccagagagatctctacagagatgtgatgttggagaac
tacaagaatctcattatactagcagggtctgaattattcaaacgtagtctcatgtctgga
ttggaacaaatggaagagctgaggacaggagtgacaggagttctgcaggaattggatttg
caactcaaaaccaaaggctccccactgctgcaagatatttctgcagaaagatcaccaaat
ggagtacaattggagagaagcaatactgcagagaaactgtatgactctaaccattctgga
aaagtcttcaatgaacacccatttcttatgactcacatgataactcacattggagagaaa
acttctgaggataatcagagtggaaaagccttaagaaagaactttcctcatagtttttac
aagaaaagtcatgctgaggggaaaatgcctaagtgtgttaaacatgaaaaagccttcaac
cagtttccaaatcttactaggcagaataaaactcacacacaagagaaattgtgtgaatgc
aaagactgttggagaacttttcttaatcagtcatcccttaagttacatataagatctcac
aatggagacaaacactatgtatgtaaggaatgtgggaaagccttcagtaattcctcacac
cttataggacatggaagaattcacagtggagagaagccctatgtctgtaaagaatgtggt
aaagctttcactcaatccacaggacttaaattacacatcagaactcacagtggagaaaaa
ccatataaatgtaaagagtgtgggaaagccttcacccattcttcataccttactgatcat
acaagaatccacagtggaaagaagccctatgtatgtatggaatgtggaaaagccttcact
agatccacaggacttattttacacatgcgaattcacactggagaaaagccatatgaatgt
aaggagtgtggaaaagcttttattcattcctcataccttacaaaacatgtaaggattcac
agtggagagaagctgtatttatgtaaggcatgtgggaaagcttttactcgttcctcagga
cttgttttacacatgagaacacatactggagaaaagccctatgaatgtaaagaatgtggg
aaagcctttaataattcctcaatgcttagtcaacatgtaaggattcacactggagagaag
ccatatgaatgcaaagaatgtgggaaagctttcactcaatcctcgggccttagtacccat
ttaagaactcacactggagaaaaggcctgtgaatgtaaggaatgcggtaaagcatttgct
cgttccacaaatcttaatatgcacatgcgaacgcacacaggagaaaagccttatgcatgt
aaagaatgtgggaaagccttcaggtattccacataccttaacgttcacacacgaactcac
actggagcaaaaccatatgaatgtaagaaatgtgggaaaaacttcactcaatcttcagca
cttgctaaacatctaagaactaaggcatgtgaaaaaacctga

DBGET integrated database retrieval system