KEGG   Homo sapiens (human): 1638
Entry
1638              CDS       T01001                                 

Gene name
DCT, TRP-2, TYRP2
Definition
(RefSeq) dopachrome tautomerase
  KO
K01827  dopachrome tautomerase [EC:5.3.3.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    1638 (DCT)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    1638 (DCT)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.12  L-dopachrome isomerase
     1638 (DCT)
SSDB
Motif
Pfam: Tyrosinase PetG PsbH
Other DBs
NCBI-GeneID: 1638
NCBI-ProteinID: NP_001913
OMIM: 191275
HGNC: 2709
Ensembl: ENSG00000080166
Vega: OTTHUMG00000017206
Pharos: P40126(Tbio)
UniProt: P40126
LinkDB
Position
13q32.1
AA seq 519 aa
MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQ
CTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCER
KKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCS
VYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESF
ALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCN
GTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGT
LDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQE
LAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTLLVVMGTL
VALVGLFVLLAFLQYRRLRKGYTPLMETHLSSKRYTEEA
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgagccccctttggtgggggtttctgctcagttgcttgggctgcaaaatcctgccagga
gcccagggtcagttcccccgagtctgcatgacggtggacagcctagtgaacaaggagtgc
tgcccacgcctgggtgcagagtcggccaatgtctgtggctctcagcaaggccgggggcag
tgcacagaggtgcgagccgacacaaggccctggagtggtccctacatcctacgaaaccag
gatgaccgtgagctgtggccaagaaaattcttccaccggacctgcaagtgcacaggaaac
tttgccggctataattgtggagactgcaagtttggctggaccggtcccaactgcgagcgg
aagaaaccaccagtgattcggcagaacatccattccttgagtcctcaggaaagagagcag
ttcttgggcgccttagatctcgcgaagaagagagtacaccccgactacgtgatcaccaca
caacactggctgggcctgcttgggcccaatggaacccagccgcagtttgccaactgcagt
gtttatgatttttttgtgtggctccattattattctgttagagatacattattaggacca
ggacgcccctacagggccatagatttctcacatcaaggacctgcatttgttacctggcac
cggtaccatttgttgtgtctggaaagagatctccagcgactcattggcaatgagtctttt
gctttgccctactggaactttgccactgggaggaacgagtgtgatgtgtgtacagaccag
ctgtttggggcagcgagaccagacgatccgactctgattagtcggaactcaagattctcc
agctgggaaactgtctgtgatagcttggatgactacaaccacctggtcaccttgtgcaat
ggaacctatgaaggtttgctgagaagaaatcaaatgggaagaaacagcatgaaattgcca
accttaaaagacatacgagattgcctgtctctccagaagtttgacaatcctcccttcttc
cagaactctaccttcagtttcaggaatgctttggaagggtttgataaagcagatgggact
ctggattctcaagtgatgagccttcataatttggttcattccttcctgaacgggacaaac
gctttgccacattcagccgccaatgatcccatttttgtggttcttcattcctttactgat
gccatctttgatgagtggatgaaaagatttaatcctcctgcagatgcctggcctcaggag
ctggcccctattggtcacaatcggatgtacaacatggttcctttcttccctccagtgact
aatgaagaactctttttaacctcagaccaacttggctacagctatgccatcgatctgcca
gtttcagttgaagaaactccaggttggcccacaactctcttagtagtcatgggaacactg
gtggctttggttggtctttttgtgctgttggcttttcttcaatatagaagacttcgaaaa
ggatatacacccctaatggagacacatttaagcagcaagagatacacagaagaagcctag

DBGET integrated database retrieval system