KEGG   Homo sapiens (human): 167127
Entry
167127            CDS       T01001                                 

Gene name
UGT3A2
Definition
(RefSeq) UDP glycosyltransferase family 3 member A2
  KO
K24103  UDP-glycosyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    167127 (UGT3A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     167127 (UGT3A2)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_4
Other DBs
NCBI-GeneID: 167127
NCBI-ProteinID: NP_777574
OMIM: 616384
HGNC: 27266
Ensembl: ENSG00000168671
Vega: OTTHUMG00000131108
Pharos: Q3SY77(Tbio)
UniProt: Q3SY77
LinkDB
Position
5p13.2
AA seq 523 aa
MAGQRVLLLVGFLLPGVLLSEAAKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLNHKR
GPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQ
CSHFLNRKDIMDSLKNENFDMVIVETFDYCPFLIAEKLGKPFVAILSTSFGSLEFGLPIP
LSYVPVFRSLLTDHMDFWGRVKNFLMFFSFCRRQQHMQSTFDNTIKEHFTEGSRPVLSHL
LLKAELWFINSDFAFDFARPLLPNTVYVGGLMEKPIKPVPQDLENFIAKFGDSGFVLVTL
GSMVNTCQNPEIFKEMNNAFAHLPQGVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAH
PSIRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETL
ALKMKQIMEDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPW
HEQYLLDVFVFLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctgggcagcgagtgcttcttctagtgggcttccttctccctggggtcctgctctca
gaggctgccaaaatcctgacaatatctacagtaggtggaagccattatctactgatggac
cgggtttctcagattcttcaagatcacggtcataatgtcaccatgcttaaccacaaaaga
ggtccttttatgccagattttaaaaaggaagaaaaatcatatcaagttatcagttggctt
gcacctgaagatcatcaaagagaatttaaaaagagttttgatttctttctggaagaaact
ttaggtggcagaggaaaatttgaaaacttattaaatgttctagaatacttggcgttgcag
tgcagtcattttttaaatagaaaggatatcatggattccttaaagaatgagaacttcgac
atggtgatagttgaaacttttgactactgtcctttcctgattgctgagaagcttgggaag
ccatttgtggccattctttccacttcattcggctctttggaatttgggctaccaatcccc
ttgtcttatgttccagtattccgttccttgctgactgatcacatggacttctggggccga
gtgaagaattttctgatgttctttagtttctgcaggaggcaacagcacatgcagtctaca
tttgacaacaccatcaaggaacatttcacagaaggctctaggccagttttgtctcatctt
ctactgaaagcagagttgtggttcattaactctgactttgcctttgattttgctcgacct
ctgcttcccaacactgtttatgttggaggcttgatggaaaaacctattaaaccagtacca
caagacttggagaacttcattgccaagtttggggactctggttttgtccttgtgaccttg
ggctccatggtgaacacctgtcagaatccggaaatcttcaaggagatgaacaatgccttt
gctcacctaccccaaggggtgatatggaagtgtcagtgttctcattggcccaaagatgtc
cacctggctgcaaatgtgaaaattgtggactggcttcctcagagtgacctcctggctcac
ccaagcatccgtctgtttgtcacccacggcgggcagaatagcataatggaggccatccag
catggtgtgcccatggtggggatccctctctttggagaccagcctgaaaacatggtccga
gtagaagccaaaaagtttggtgtttctattcagttaaagaagctcaaggcagagacattg
gctcttaagatgaaacaaatcatggaagacaagagatacaagtccgcggcagtggctgcc
agtgtcatcctgcgctcccacccgctcagccccacacagcggctggtgggctggattgac
cacgtcctccagacagggggcgcgacgcacctcaagccctatgtctttcagcagccctgg
catgagcagtacctgctcgacgtttttgtgtttctgctggggctcactctggggactcta
tggctttgtgggaagctgctgggcatggctgtctggtggctgcgtggggccagaaaggtg
aaggagacataa

DBGET integrated database retrieval system