KEGG   Homo sapiens (human): 170572
Entry
170572            CDS       T01001                                 

Gene name
HTR3C
Definition
(RefSeq) 5-hydroxytryptamine receptor 3C
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829<US> D07129
Azasetron (DG01521): D01613<JP> D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283<JP/US>
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725<US> D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563<JP/US> D11056
Ondansetron (DG00060): D00456<US> D00678<JP/US>
Palonosetron (DG00064): D05343<JP/US> D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016<JP> D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185<JP/US>
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    170572 (HTR3C)
  09157 Sensory system
   04742 Taste transduction
    170572 (HTR3C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    170572 (HTR3C)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   170572 (HTR3C)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 170572
NCBI-ProteinID: NP_570126
OMIM: 610121
HGNC: 24003
Ensembl: ENSG00000178084
Vega: OTTHUMG00000156862
Pharos: Q8WXA8(Tchem)
UniProt: Q8WXA8
LinkDB
Position
3q27.1
AA seq 447 aa
MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNY
SIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENL
WLPDIFIVESMDVDQTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF
SSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFY
VAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLL
PASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLLHCTSPGRC
CPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH
AMDTLLFRLYLLFMASSILTVIVLWNT
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggaaggagggtggcctgcaaggcagagtgccctcctctgcctcactgtcagtcttctg
cttcaaggaagaggcgacgcttttaccatcaattgctcaggctttgaccagcatggggtt
gaccctgctgtcttccaagcagtgtttgacagaaaggccttccgtccattcaccaactac
agcatccctacccgtgtcaacatctccttcaccctgtctgccatcctgggagtggatgca
cagctccagctgctgacatcattcctgtggatggatttggtatgggacaatcctttcatt
aattggaacccaaaagagtgtgttggcatcaataaactcacagtattagctgaaaacctg
tggctcccagacatcttcatcgtggaatccatggatgtggatcagacgccttccggtctc
actgcctatatcagcagtgaaggtcgaattaagtatgataagccaatgagggtgaccagc
atctgtaacctggacatcttctacttcccttttgaccaacagaactgtaccttcaccttc
agttctttcctctacacagtggacagcatgctgctgggcatggacaaggaggtgtgggag
atcacagacacgtctcgcaaagtcatccaaacccagggggagtgggagctcttgggcatc
aacaaggccaccccaaagatgtccatgggcaacaacctatatgaccagatcatgttttat
gtggccatcaggcgcaggccaagcctctacatcataaacctgctggtgcccagtagcttt
ctggttgccattgatgccctcagcttctacctgccagcagagagcgagaatcgtgcccca
ttcaagataacacttctgctgggctacaacgtcttcctgctcatgatgaatgacttgctc
cctgccagtggcacccccctcatcagtgtctacttcgccctgtgcctgtccctgatggtg
gtcagcctgctggagaccgtcttcattacctacctgctgcacgtggccaccacccagccc
ccacccatgcctaggtggcttcactccctgctgctccactgcaccagcccagggagatgc
tgtcccactgcgccccagaagggaaataagggcctgggtctcaccctcacccacctgcct
ggcccaaaggagccgggggagttagcagggaagaagctgggacccagagagaccgagcca
gatgggggctcaggatggacaaagacccagctaatggagctgtgggtgcagttcagccac
gcgatggacaccctgctcttccgcctctacctgctcttcatggcctcctccatccttact
gtcattgtcctctggaacacctag

KEGG   Homo sapiens (human): 200909
Entry
200909            CDS       T01001                                 

Gene name
HTR3D, 5HT3D
Definition
(RefSeq) 5-hydroxytryptamine receptor 3D
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829<US> D07129
Azasetron (DG01521): D01613<JP> D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283<JP/US>
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725<US> D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563<JP/US> D11056
Ondansetron (DG00060): D00456<US> D00678<JP/US>
Palonosetron (DG00064): D05343<JP/US> D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016<JP> D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185<JP/US>
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    200909 (HTR3D)
  09157 Sensory system
   04742 Taste transduction
    200909 (HTR3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    200909 (HTR3D)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   200909 (HTR3D)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 200909
NCBI-ProteinID: NP_001157118
OMIM: 610122
HGNC: 24004
Ensembl: ENSG00000186090
Vega: OTTHUMG00000156858
Pharos: Q70Z44(Tchem)
UniProt: Q70Z44
LinkDB
Position
3q27.1
AA seq 454 aa
MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcagaaacactctccaggccccccagccctggccctcctctctcagtctctgctcact
acaggaaatggcgacactttgattatcaattgcccaggctttggccagcacagggtggac
cctgcagcctttcaagcagtgtttgacagaaaggctattggtccagtcaccaactacagt
gtcgccactcatgtcaacatctccttcaccttgtctgccatctggaactgctattccagg
attcacaccttcaactgccaccatgcccggccttggcacaatcaatttgtgcagtggaac
ccagatgaatgcggaggcatcaagaagtccggcatggcaactgagaacctatggctttca
gatgtcttcatcgaggagtctgtggatcagacacctgcaggtctcatggctagtatgtca
atagtgaaggccacatcaaacacaataagccaatgtgggtggtcagcatctgcaaactgg
acaccttctatttccccttccatggacagagcccgggcatggagaaggatgtccaggagc
tttcaaatacatcacagaacctcattcagaacaaggagggagtgggtactgctgggtatc
caaaaaagaacaataaaggtgaccgtggccactaaccagtatgaacaagccatcttccat
gtggccatcaggcgcaggtgcaggcccagcccctacgtggtaaactttctggtgcccagt
ggcattctgattgccatcgatgccctcagtttctacctgccactggaaagtgggaattgt
gccccattcaagatgactgttctgctgggctacagcgtcttcctgctcatgatgaatgac
ttgctcccagccactagcacttcatcacatgcttcactagtggcgcctctggccctcatg
cagacccccttgcctgcaggtgtctacttcgccctgtgcctgtccctgatggtgggcagc
ctgctggagaccatcttcatcacccacctgctgcacgtggccaccacccagcccctacct
ctgcctcggtggctccactccctgctgctgcactgcaccggccaagggagatgctgtccc
actgcgccccagaagggaaataagggcccgggtctcacccccacccacctgcccggtgtg
aaggagccagaggtatcagcagggcagatgccaggccctggggaggcagagctgacaggg
ggctcagaatggacaagggcccagcgggaacacgaggcccagaagcagcactcggtggag
ctgtgggtgcagttcagccacgcgatggacgccctgctcttccgcctctacctgctcttc
atggcctcctccatcatcaccgtcatatgcctctggaacacctag

KEGG   Homo sapiens (human): 285242
Entry
285242            CDS       T01001                                 

Gene name
HTR3E, 5-HT3-E, 5-HT3E, 5-HT3c1
Definition
(RefSeq) 5-hydroxytryptamine receptor 3E
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829<US> D07129
Azasetron (DG01521): D01613<JP> D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283<JP/US>
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725<US> D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563<JP/US> D11056
Ondansetron (DG00060): D00456<US> D00678<JP/US>
Palonosetron (DG00064): D05343<JP/US> D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016<JP> D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185<JP/US>
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    285242 (HTR3E)
  09157 Sensory system
   04742 Taste transduction
    285242 (HTR3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    285242 (HTR3E)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   285242 (HTR3E)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 285242
NCBI-ProteinID: NP_001243542
OMIM: 610123
HGNC: 24005
Ensembl: ENSG00000186038
Vega: OTTHUMG00000156857
Pharos: A5X5Y0(Tchem)
UniProt: A5X5Y0
LinkDB
Position
3q27.1
AA seq 456 aa
MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNI
SVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNL
WLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTF
SSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFY
VAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLL
PTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRC
CPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS
VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggaaggaagctggttccacaggaaaagattttccttctacctccttctcggttttctg
cttcaaggaaggggcgttactttcaccatcaattgctcagggtttggccagcacggggcg
gatcccactgctctgaattcagtgtttaatagaaagcccttccgtccggtcaccaacatc
agcgtccccacccaagtcaacatctccttcgcgatgtctgccatcctagatgtgaatgaa
cagctgcacctcttgtcatcattcctgtggctggaaatggtttgggataacccatttatc
agctggaacccagaggaatgtgagggcatcacgaagatgagtatggcagccaagaacctg
tggctcccagacattttcatcattgaactcatggatgtggataagaccccaaaaggcctc
acagcatatgtaagtaatgaaggtcgcatcaggtataagaaacccatgaaggtggacagt
atctgtaacctggacatcttctacttccccttcgaccagcagaactgcacactcaccttc
agctcattcctctacacagtggacagcatgttgctggacatggagaaagaagtgtgggaa
ataacagacgcatcccggaacatccttcagacccatggagaatgggagctcctgggcctc
agcaaggccaccgcaaagttgtccaggggaggcaacctgtatgatcagatcgtgttctat
gtggccatcaggcgcaggcccagtctctatgtcataaaccttctcgtgcccagtggcttt
ctggttgccatcgatgccctcagcttctacctgccagtgaaaagtgggaatcgtgtccca
ttcaagataacgctcctgctgggctacaacgtcttcctgctcatgatgagtgacttgctc
cccaccagtggcacccccctcatcggtgtctacttcgccctgtgcctgtccctgatggtg
ggcagcctgctggagaccatcttcatcacccacctgctgcacgtggccaccacccagccc
ccacccctgcctcggtggctccactccctgctgctccactgcaacagcccggggagatgc
tgtcccactgcgccccagaaggaaaataagggcccgggtctcacccccacccacctgccc
ggtgtgaaggagccagaggtatcagcagggcagatgccgggccctgcggaggcagagctg
acagggggctcagaatggacaagggcccagcgggaacacgaggcccagaagcagcactca
gtggagctgtggttgcagttcagccacgcgatggacgccatgctcttccgcctctacctg
ctcttcatggcctcctctatcatcaccgtcatatgcctctggaacacctag

KEGG   Homo sapiens (human): 3359
Entry
3359              CDS       T01001                                 

Gene name
HTR3A, 5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829<US> D07129
Azasetron (DG01521): D01613<JP> D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Cisapride (DG00056): D00274 D02092
Clozapine: D00283<JP/US>
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725<US> D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563<JP/US> D11056
Ondansetron (DG00060): D00456<US> D00678<JP/US>
Palonosetron (DG00064): D05343<JP/US> D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016<JP> D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185<JP/US>
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3359 (HTR3A)
  09157 Sensory system
   04742 Taste transduction
    3359 (HTR3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3359 (HTR3A)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   3359 (HTR3A)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 3359
NCBI-ProteinID: NP_000860
OMIM: 182139
HGNC: 5297
Ensembl: ENSG00000166736
Vega: OTTHUMG00000160494
Pharos: P46098(Tclin)
UniProt: P46098 B4E398
LinkDB
Position
11q23.2
AA seq 478 aa
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgctgctgtgggtccagcaggcgctgctcgccttgctcctccccacactcctggcacag
ggagaagccaggaggagccgaaacaccaccaggcccgctctgctgaggctgtcggattac
cttttgaccaactacaggaagggtgtgcgccccgtgagggactggaggaagccaaccacc
gtatccattgacgtcattgtctatgccatcctcaacgtggatgagaagaatcaggtgctg
accacctacatctggtaccggcagtactggactgatgagtttctccagtggaaccctgag
gactttgacaacatcaccaagttgtccatccccacggacagcatctgggtcccggacatt
ctcatcaatgagttcgtggatgtggggaagtctccaaatatcccgtacgtgtatattcgg
catcaaggcgaagttcagaactacaagccccttcaggtggtgactgcctgtagcctcgac
atctacaacttccccttcgatgtccagaactgctcgctgaccttcaccagttggctgcac
accatccaggacatcaacatctctttgtggcgcttgccagaaaaggtgaaatccgacagg
agtgtcttcatgaaccagggagagtgggagttgctgggggtgctgccctactttcgggag
ttcagcatggaaagcagtaactactatgcagaaatgaagttctatgtggtcatccgccgg
cggcccctcttctatgtggtcagcctgctactgcccagcatcttcctcatggtcatggac
atcgtgggcttctacctgccccccaacagtggcgagagggtctctttcaagattacactc
ctcctgggctactcggtcttcctgatcatcgtttctgacacgctgccggccactgccatc
ggcactcctctcattggtgtctactttgtggtgtgcatggctctgctggtgataagtttg
gccgagaccatcttcattgtgcggctggtgcacaagcaagacctgcagcagcccgtgcct
gcttggctgcgtcacctggttctggagagaatcgcctggctactttgcctgagggagcag
tcaacttcccagaggcccccagccacctcccaagccaccaagactgatgactgctcagcc
atgggaaaccactgcagccacatgggaggaccccaggacttcgagaagagcccgagggac
agatgtagccctcccccaccacctcgggaggcctcgctggcggtgtgtgggctgctgcag
gagctgtcctccatccggcaattcctggaaaagcgggatgagatccgagaggtggcccga
gactggctgcgcgtgggctccgtgctggacaagctgctattccacatttacctgctagcg
gtgctggcctacagcatcaccctggttatgctctggtccatctggcagtacgcttga

KEGG   Homo sapiens (human): 9177
Entry
9177              CDS       T01001                                 

Gene name
HTR3B, 5-HT3B
Definition
(RefSeq) 5-hydroxytryptamine receptor 3B
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829<US> D07129
Azasetron (DG01521): D01613<JP> D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283<JP/US>
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725<US> D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Granisetron (DG00061): D00677<JP/US> D04370<US>
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563<JP/US> D11056
Ondansetron (DG00060): D00456<US> D00678<JP/US>
Palonosetron (DG00064): D05343<JP/US> D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016<JP> D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185<JP/US>
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    9177 (HTR3B)
  09157 Sensory system
   04742 Taste transduction
    9177 (HTR3B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9177 (HTR3B)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   9177 (HTR3B)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 9177
NCBI-ProteinID: NP_006019
OMIM: 604654
HGNC: 5298
Ensembl: ENSG00000149305
Vega: OTTHUMG00000168210
Pharos: O95264(Tchem)
UniProt: O95264
LinkDB
Position
11q23.2
AA seq 441 aa
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII
NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA
VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
LFMLGIYTITLCSLWALWGGV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgttgtcaagtgtaatggctcccctgtgggcctgcatcctggtggctgcaggaattcta
gccacagatacacatcatccccaggattctgctctgtatcatctcagcaagcagctatta
cagaaatatcataaagaagtgagacctgtttacaactggaccaaggccaccacagtctac
ctggacctgttcgtccatgctatattggatgtggatgcagagaatcaaatattaaagaca
agtgtatggtaccaagaggtctggaatgatgaatttttatcctggaactccagcatgttt
gatgagattagagagatctccctacctctaagtgccatctgggcccccgatatcatcatc
aatgagtttgtggacattgaaagataccctgaccttccctatgtttatgtgaactcatct
gggaccattgagaactataagcccatccaggtggtctctgcgtgcagtttagagacatat
gcttttccatttgatgtccagaattgcagcctgaccttcaagagcattctgcatacagtg
gaagacgtagacctggcctttctgaggagcccagaagacattcagcatgacaaaaaggcg
tttttgaatgacagtgagtgggaacttctatctgtgtcctccacatacagcatcctgcag
agcagcgctggaggatttgcacagattcagtttaatgtggtgatgcgcaggcaccccctg
gtctatgtcgtgagtctgctgattcctagcatctttctcatgctggtggacctggggagc
ttctacctgccacccaactgccgagccaggattgtgttcaagaccagtgtgctggtgggc
tacaccgtcttcagggtcaacatgtccaaccaggtgccacggagtgtagggagcacccct
ctgattgggcacttcttcaccatctgcatggccttcttggttctcagcttagctaagtcc
atcgtgttggtcaaattcctccatgatgagcagcgtggtggacaggagcagcccttcttg
tgccttcgaggggacaccgatgctgacaggcctagagtggaacccagggcccaacgtgct
gtggtaacagagtcctcgctgtatggagagcacctggcccagccaggaaccctgaaggaa
gtctggtcgcagcttcaatctatcagcaactacctccaaactcaggaccagacagaccaa
caggaggcagagtggctggtcctcctgtcccgctttgaccgactgctcttccaaagctac
cttttcatgctggggatctacaccatcactctgtgctccctctgggcactgtggggcggc
gtgtga

DBGET integrated database retrieval system