KEGG   Homo sapiens (human): 171558Help
Entry
171558            CDS       T01001                                 

Gene name
PTCRA, PT-ALPHA, PTA
Definition
(RefSeq) pre T cell antigen receptor alpha
  KO
K06056  pre T-cell antigen receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00122  LMO2-rearrangement to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    171558 (PTCRA)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    171558 (PTCRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTCRA C1-set
Motif
Other DBs
NCBI-GeneID: 171558
NCBI-ProteinID: NP_612153
OMIM: 606817
HGNC: 21290
Ensembl: ENSG00000171611
Vega: OTTHUMG00000014709
Pharos: Q6ISU1(Tbio)
UniProt: Q6ISU1
LinkDB All DBs
Structure
PDB: 

Position
6p21.1
AA seq 281 aa AA seqDB search
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSP
IWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRST
QPMHLSGEASTARTCPQEPLRGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLP
SPATTTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYL
SSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggccggtacatggctgctacttctcctggcccttgggtgtccagccctacccacaggt
gtgggcggcacaccctttccttctctggccccaccaatcatgctgctggtggatggaaag
cagcagatggtggtggtctgcctggtccttgatgttgcaccccctggccttgacagcccc
atctggttctcagccggcaatggcagtgcactggatgccttcacctatggcccttcccca
gcaacggatggcacctggaccaacttggcccatctctccctgccttctgaggagctggca
tcctgggagcctttggtctgccacactgggcctggggctgagggtcacagcaggagtaca
cagcccatgcatctgtcaggagaggcttctacagccaggacctgcccccaggagcctctc
agggggacaccgggtggggcgctgtggctgggggtcctgcggctgctgctcttcaagctg
ctgctgtttgacctgctcctgacctgcagctgcctgtgcgaccccgcgggcccgctgcct
tcccccgcaaccaccacccgcctgcgagccctcggctcccatcgactgcacccggccacg
gagactgggggacgagaggccaccagctcacccagaccccagcctcgggaccgccgctgg
ggtgacacccctccgggtcggaagcccgggagcccagtatggggggaagggtcttacctc
agcagttaccccacttgcccagcacaggcctggtgctcaagatctgccctcagggctcct
tcctccagtcttggagcattttttgcaggtgacctgcctcctcctctgcaggctggagct
gcctga

DBGET integrated database retrieval system