KEGG   Homo sapiens (human): 1727Help
Entry
1727              CDS       T01001                                 

Gene name
CYB5R3, B5R, DIA1
Definition
(RefSeq) cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
Disease
H00235  Methemoglobinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    1727 (CYB5R3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     1727 (CYB5R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 1727
NCBI-ProteinID: NP_000389
OMIM: 613213
HGNC: 2873
Ensembl: ENSG00000100243
Vega: OTTHUMG00000150745
Pharos: P00387(Tbio)
UniProt: P00387
LinkDB All DBs
Structure
PDB: 

Position
22q13.2
AA seq 301 aa AA seqDB search
MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD
RAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFV
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctcagcacgttgggccatatggtgctcttcccagtctggttcctgtac
agtctgctcatgaagctgttccagcgctccacgccagccatcaccctcgagagcccggac
atcaagtacccgctgcggctcatcgaccgggagatcatcagccatgacacccggcgcttc
cgctttgccctgccgtcaccccagcacatcctgggcctccctgtcggccagcacatctac
ctctcggctcgaattgatggaaacctggtcgtccggccctatacacccatctccagcgat
gatgacaagggcttcgtggacctggtcatcaaggtttacttcaaggacacccatcccaag
tttcccgctggagggaagatgtctcagtacctggagagcatgcagattggagacaccatt
gagttccggggccccagtgggctgctggtctaccagggcaaagggaagttcgccatccga
cctgacaaaaagtccaaccctatcatcaggacagtgaagtctgtgggcatgatcgcggga
gggacaggcatcaccccgatgctgcaggtgatccgcgccatcatgaaggaccctgatgac
cacactgtgtgccacctgctctttgccaaccagaccgagaaggacatcctgctgcgacct
gagctggaggaactcaggaacaaacattctgcacgcttcaagctctggtacacgctggac
agagcccctgaagcctgggactacggccagggcttcgtgaatgaggagatgatccgggac
caccttccacccccagaggaggagccgctggtgctgatgtgtggccccccacccatgatc
cagtacgcctgccttcccaacctggaccacgtgggccaccccacggagcgctgcttcgtc
ttctga

DBGET integrated database retrieval system