KEGG   Homo sapiens (human): 1735Help
Entry
1735              CDS       T01001                                 

Gene name
DIO3, 5DIII, D3, DIOIII, TXDI3
Definition
(RefSeq) iodothyronine deiodinase 3
  KO
K07754  thyroxine 5-deiodinase [EC:1.21.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    1735 (DIO3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.3  thyroxine 5-deiodinase
     1735 (DIO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T4_deiodinase AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 1735
NCBI-ProteinID: NP_001353
OMIM: 601038
HGNC: 2885
Ensembl: ENSG00000197406
Vega: OTTHUMG00000160681
Pharos: P55073(Tbio)
UniProt: P55073 Q86TU3
LinkDB All DBs
Position
14q32.31
AA seq 304 aa AA seqDB search
MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLW
LLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHG
QKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAF
QRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCA
LVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGAR
PRRV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgccaggccacgtcgcggttggtggtcggagagggcgaggggtcccagggggct
tcggggcctgcagccaccatgctccgctccctgctgcttcactccttgaggctctgcgcc
cagaccgcctcgtgcctcgtgctcttcccgcgcttcctcggcacggccttcatgctctgg
cttctcgatttcttgtgtatccgcaagcatttcctgggccgccgccgccgggggcagccc
gagcccgaagtggagctcaacagtgaaggcgaggaggtgcctcccgatgacccgcccatc
tgcgtgtccgacgacaaccgcctgtgcaccctggcgtcgctcaaggcggtgtggcatggc
cagaagttggatttcttcaagcaggcgcacgagggcggtccggcgcccaactccgaggtg
gttctgcccgacggcttccagagccagcacatcctcgactacgcgcaagggaaccgcccg
ctggttctcaatttcggcagctgcacctgaccaccgttcatggcgcgcatgagcgccttc
cagcgcctggtcactaagtaccagcgcgacgtcgacttcctcatcatctacatcgaggaa
gcgcacccctccgacggctgggtcaccacggactctccctacatcatcccacagcaccgg
agcctggaggaccgggtcagcgcagcgagggtactgcagcaaggtgcacccggctgcgct
ctggtcctcgacaccatggccaactccagcagctcggcctatggcgcctacttcgagcgt
ctctatgtcatccagagtggcactattatgtaccagggcggccgtggccccgacggctac
caggtctctgagctgcgcacttggttggaacgctatgatgagcaactgcacggcgctcgg
ccccggagggtgtaa

DBGET integrated database retrieval system