KEGG   Homo sapiens (human): 1740
Entry
1740              CDS       T01001                                 

Gene name
DLG2, PPP1R58, PSD-93, PSD93, chapsyn-110
Definition
(RefSeq) discs large MAGUK scaffold protein 2
  KO
K12075  discs large protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1740 (DLG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1740 (DLG2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1740 (DLG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    1740 (DLG2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     1740 (DLG2)
SSDB
Motif
Pfam: PDZ Guanylate_kin MAGUK_N_PEST PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 1740
NCBI-ProteinID: NP_001355
OMIM: 603583
HGNC: 2901
Ensembl: ENSG00000150672
Vega: OTTHUMG00000134309
Pharos: Q15700(Tbio)
UniProt: Q15700
LinkDB
Structure
PDB: 
2HE2 2BYG

Position
11q14.1
AA seq 870 aa
MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVL
QSHISPLKASPAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPH
IGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLY
VRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQ
VGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGKPTTIYMTDPYGPPDITHSYSPP
MENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKPAS
PRHYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATRQPSMTLQRAVSLEGEPR
KVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASH
EQAAAALKGAGQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLY
VRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKR
RVERKERARLKTVKFNAKPGVIDSKGSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPER
GQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYE
VDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNA
IKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQG
DTLEDIYNQCKLVIEEQSGPFIWIPSKEKL
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgttctttgcatgttactgtgcactccggactaacgtgaagaagtatcgatatcaagat
gaggacgctccacatgatcattccttacctcgactaacccacgaagtaagaggcccagaa
ctcgtgcatgtatcagaaaagaacctctctcaaatagaaaatgtccatggatatgtcttg
cagtctcatatttctcctctgaaggccagtcctgctcctataattgtcaacacagatact
ttggacacaattccttatgtcaatgggacagaaattgaatatgaatttgaagaaattaca
ctggagagggggaattctggcctgggattcagtattgctggggggacagataatccccac
attggagatgaccctggcatatttattacgaagattataccaggaggtgctgcagcagag
gatggcagactcagggtcaatgattgtatcttgcgggtgaatgaggttgatgtgtcagag
gtttcccacagtaaagcggtggaagccctgaaggaagcagggtctatcgttcggctgtat
gtgcgtagaagacgacctattttggagaccgttgtggaaatcaaactgttcaaaggccct
aaaggtttaggcttcagtattgcaggaggtgtggggaaccaacacattcctggagacaac
agcatttatgtaactaaaattatagatggaggagctgcacaaaaagatggaaggttgcaa
gtaggagatagactactaatggtaaacaactacagtttagaagaagtaacacacgaagag
gcagtagcaatattaaagaacacatcagaggtagtttatttaaaagttggcaaacccact
accatttatatgactgatccttatggtccacctgatattactcactcttattctccacca
atggaaaaccatctactctctggcaacaatggcactttagaatataaaacctccctgcca
cccatctctccaggaaggtactcaccaattccaaagcacatgcttgttgacgacgactac
accaggcctccggaacctgtttacagcactgtgaacaaactatgtgataagcctgcttct
cccaggcactattcccctgttgagtgtgacaaaagcttcctcctctcagctccctattcc
cactaccacctaggcctgctacctgactctgagatgaccagtcattcccaacatagcacc
gcaactcgtcagccttcaatgactctccaacgggccgtctccctggaaggagagcctcgc
aaggtagtcctgcacaaaggctccactggcctgggcttcaacattgtcggtggggaagat
ggagaaggtatttttgtgtccttcattctggctggtggaccagcagacctaagtggggag
ctccagagaggagaccagatcctatcggtgaatggcattgacctccgtggtgcatcccac
gagcaggcagctgctgcactaaagggggctggacagacagtgacgattatagcacaatat
caacctgaagattacgctcgatttgaggccaaaatccatgacctacgagagcagatgatg
aaccacagcatgagctccgggtccggatccctgcgaaccaatcagaaacgctccctctac
gtcagagccatgttcgactacgacaagagcaaggacagtgggctgccaagtcaaggactt
agttttaaatatggagatattctccacgttatcaatgcctctgatgatgagtggtggcaa
gccaggagagtcatgctggagggagacagtgaggagatgggggtcatccccagcaaaagg
agggtggaaagaaaggaacgtgcccgattgaagacagtgaagtttaatgccaaacctgga
gtgattgattcgaaagggtcattcaatgacaagcgtaaaaagagcttcatcttttcacga
aaattcccattctacaagaacaaggagcagagtgagcaggaaaccagtgatcctgaacga
ggacaagaagacctcattctttcctatgagcctgttacaaggcaggaaataaactacacc
cggccggtgattatcctggggcccatgaaggatcggatcaatgacgacttgatatctgaa
ttccctgataaatttggctcctgtgtgcctcatactacgaggccaaagcgagactacgag
gtggatggcagagactatcactttgtcatttccagagaacaaatggagaaagatatccaa
gagcacaagtttatagaagccggccagtacaatgacaatttatatggaaccagtgtgcag
tctgtgagatttgtagcagaaagaggcaaacactgtatacttgatgtatcaggaaatgct
atcaagcggttacaagttgcccagctctatcccattgccatcttcataaaacccaggtct
ctggaacctcttatggagatgaataagcgtctaacagaggaacaagccaagaaaacctat
gatcgagcaattaagctagaacaagaatttggagaatattttacagctattgtccaagga
gatactttagaagatatatataaccaatgcaagcttgttattgaagagcaatctgggcct
ttcatctggattccctcaaaggaaaagttataa

DBGET integrated database retrieval system