KEGG   Homo sapiens (human): 1749
Entry
1749              CDS       T01001                                 

Gene name
DLX5, SHFM1, SHFM1D
Definition
(RefSeq) distal-less homeobox 5
  KO
K18489  homeobox protein DLX5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00471  Split-hand/foot malformation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1749 (DLX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1749 (DLX5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Dll
    1749 (DLX5)
SSDB
Motif
Pfam: DLL_N Homeodomain Homeobox_KN YdaS_antitoxin
Other DBs
NCBI-GeneID: 1749
NCBI-ProteinID: NP_005212
OMIM: 600028
HGNC: 2918
Ensembl: ENSG00000105880
Vega: OTTHUMG00000154200
Pharos: P56178(Tbio)
UniProt: P56178 Q53Y73
LinkDB
Structure
PDB: 
4RDU 2DJN

Position
7q21.3
AA seq 289 aa
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCS
PTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK
EVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ
VKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAH
PPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
NT seq 870 nt   +upstreamnt  +downstreamnt
atgacaggagtgtttgacagaagggtccccagcatccgatccggcgacttccaagctccg
ttccagacgtccgcagctatgcaccatccgtctcaggaatcgccaactttgcccgagtct
tcagctaccgattctgactactacagccctacggggggagccccgcacggctactgctct
cctacctcggcttcctatggcaaagctctcaacccctaccagtatcagtatcacggcgtg
aacggctccgccgggagctacccagccaaagcttatgccgactatagctacgctagctcc
taccaccagtacggcggcgcctacaaccgcgtcccaagcgccaccaaccagccagagaaa
gaagtgaccgagcccgaggtgagaatggtgaatggcaaaccaaagaaagttcgtaaaccc
aggactatttattccagctttcagctggccgcattacagagaaggtttcagaagactcag
tacctcgccttgccggaacgcgccgagctggccgcctcgctgggattgacacaaacacag
gtgaaaatctggtttcagaacaaaagatccaagatcaagaagatcatgaaaaacggggag
atgcccccggagcacagtcccagctccagcgacccaatggcgtgtaactcgccgcagtct
ccagcggtgtgggagccccagggctcgtcccgctcgctcagccaccaccctcatgcccac
cctccgacctccaaccagtccccagcgtccagctacctggagaactctgcatcctggtac
acaagtgcagccagctcaatcaattcccacctgccgccgccgggctccttacagcacccg
ctggcgctggcctccgggacactctattag

DBGET integrated database retrieval system