KEGG   Homo sapiens (human): 1758Help
Entry
1758              CDS       T01001                                 

Gene name
DMP1, ARHP, ARHR, DMP-1
Definition
(RefSeq) dentin matrix acidic phosphoprotein 1
  KO
K23328  dentin matrix acidic phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Disease
H00214  Hypophosphatemic rickets
H02139  Autosomal recessive hypophosphatemic rickets
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1758 (DMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DMP1
Motif
Other DBs
NCBI-GeneID: 1758
NCBI-ProteinID: NP_004398
OMIM: 600980
HGNC: 2932
Ensembl: ENSG00000152592
Vega: OTTHUMG00000130598
Pharos: Q13316(Tbio)
UniProt: Q13316
LinkDB All DBs
Position
4q22.1
AA seq 513 aa AA seqDB search
MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEE
QANEDPSDSTQSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSG
PGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEG
GDSTQESESEEHWVGGGSDGESSHGDGSELDDEGMQSDDPESIRSERGNSRMNSAGMKSK
ESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSN
SRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVV
SESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQ
LKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGY
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcagcatcctgctcatgttcctttggggattatcctgtgctctcccagtaacc
aggtatcaaaataatgaatctgaggattctgaagaatggaagggtcatttggctcaggca
ccaacaccacccttggagagcagtgagtcatcagaaggcagtaaagttagctcagaggaa
caggcaaatgaagaccccagtgacagcactcagtcagaggagggcctgggctctgatgat
catcaatacatttataggctagctggtggcttctccaggagcacaggaaaaggaggagat
gataaagatgacgatgaagatgacagtggagatgacacctttggtgacgatgacagtggc
ccagggcccaaagacagacaagaaggaggaaactccagactgggaagtgatgaggactct
gatgacaccatacaagccagtgaagagagtgccccacaagggcaagacagtgcccaagat
accaccagtgagagcagggaacttgacaatgaggaccgggtggacagcaagcctgaggga
ggtgactccactcaagagagtgagagtgaagagcactgggtgggaggtggcagtgatggg
gagagcagccatggagacggctccgagttggacgatgagggaatgcagagtgatgaccca
gagagcatcaggagtgaaaggggaaactccagaatgaacagtgcaggcatgaaatcaaaa
gaatctggagaaaacagtgagcaagcaaacactcaagattcaggtggcagccaattgctg
gagcatcccagtaggaaaatttttaggaagtctcgcatctcagaggaagatgacagaagc
gagcttgatgacaacaacacaatggaagaagtcaagagtgactctacagaaaacagcaac
tccagagacactggcctcagccaacccaggagagacagcaagggtgactctcaagaagac
agcaaggagaatctgtcccaggaagagagccaaaacgtagatggtcccagcagtgagtcc
agccaagaggccaacctgtcatctcaagagaacagcagtgagtctcaggaagaggtggtg
agtgagtccaggggagataaccccgaccccacaactagttatgtagaagaccaggaagac
agtgactccagcgaggaggacagctcgcacacactctcccactcaaaaagtgaatccaga
gaggagcaagcagacagcgaatccagtgagagcctcaacttctcagaggaaagcccggag
tcccctgaggatgagaacagctccagccaggagggcctccagtctcacagcagctcagca
gagagtcagagcgaggaaagccattctgaggaagacgacagtgactctcaagacagcagc
agatccaaagaagatagcaactccacggagagcaaatcaagcagtgaggaagatggccag
ttgaaaaacattgagatagagagccggaaattaacagttgatgcctatcacaacaaaccc
attggggaccaagatgacaatgactgccaagacggctattag

DBGET integrated database retrieval system