KEGG   Homo sapiens (human): 1768
Entry
1768              CDS       T01001                                 

Gene name
DNAH6, DNHL1, Dnahc6, HL-2, HL2
Definition
(RefSeq) dynein axonemal heavy chain 6
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1768 (DNAH6)
   05016 Huntington disease
    1768 (DNAH6)
   05022 Pathways of neurodegeneration - multiple diseases
    1768 (DNAH6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1768 (DNAH6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     1768 (DNAH6)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 AAA AAA_18 AAA_22 TsaE AAA_16 Sigma54_activat NB-ARC Caudo_TAP SLS
Other DBs
NCBI-GeneID: 1768
NCBI-ProteinID: NP_001361
OMIM: 603336
HGNC: 2951
Ensembl: ENSG00000115423
Vega: OTTHUMG00000128957
Pharos: Q9C0G6(Tbio)
UniProt: Q9C0G6
LinkDB
Position
2p11.2
AA seq 4158 aa
MTFRATDSEFDLTNIEEYAENSALSRLNNIKAKQRVSYVTSTENESDTQILTFRHITKAQ
EKTRKRQQPIKLEPLPVLKVYQDHKQPEYIHEQNRFQLMTAGIIKRPVSIAKKSFATSST
QFLEHQDAVKKMQIHRPYVEVFSPSPPKLPHTGIGKRGLFGTRSSAYPKYTFHDREEVVK
ANIRDPLQIIKIIRENEHLGFLYMIPAVPRSSIEYDTYNLKVVSYENINKNDYYTISQRA
VTHIYNEDIEFIEIDRWEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRSKKITGCQKS
LQKNLFIVNPHLRPALLKINELCYHLSFMGLCYIEKCHTYTLQEFKAAQVIRLAEVTERL
GEFRNEAKYVVRRACRFALRAAGFVPDDCAFGPFEDYHKVQSSGSFINTPHELPTYGDSE
KMTYTEQASKRHYCMRLTCFIRLNDYLIENTMHILTVNAVNSLLNHLTDKLKRTPSADVI
QKWITEEKPEVPDKKGTLMVEKQEEDESLIPMFLTELMLTVQSLLFEPSLEDFLDGILGA
VNHCQNTVLSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQI
KETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDA
VALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKL
EFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMK
PSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDK
IRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWD
KLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVI
IDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAA
LEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPL
KTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKE
IMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDEL
LEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSP
EGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQV
ILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTA
LITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLG
ACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSD
GLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGR
EIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKI
LARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSN
LPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFY
ETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGE
LYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLC
LANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKL
TEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAM
EQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHM
DFDTKRLDPWERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGV
GKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIV
IFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRN
PVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPPAVKQTASSIVEASVEIYNKM
SVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINN
EDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTAN
VLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLA
AHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINN
ILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSP
VGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGNEELKEKLPLMCVN
VHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLL
ETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAE
ETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLN
AKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKS
MCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEY
DKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAA
ACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDL
ISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGL
PVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLP
EVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKIL
RMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSV
MYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSR
GLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFA
CCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGYSKMKHEDKHMRQEKEAAH
QDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNT
PLVFILSTGSDPMGAFQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQN
CHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGL
RANIRRAFTEMTPSFFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSD
RECALLNLKLYCKEGKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEED
YKYSESGIYFAPMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILE
VQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQ
EVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPL
GSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKY
SVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIEDA
LPGQMNPVLPVVHFEPQQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKR
SKDYWIAKGSALLCQLSE
NT seq 12477 nt   +upstreamnt  +downstreamnt
atgacttttcgggccacagatagtgaatttgacctgacaaatattgaagagtatgccgaa
aattctgcactttcaagactgaataatataaaagccaaacaaagagtgagttatgtgaca
tccacagaaaatgaatctgatacacaaatcctaacgtttaggcacattacaaaagctcag
gagaagacaagaaaacgacagcagcctataaaactagagcctttgccagtgctaaaagtc
taccaagatcataagcagccagaatacatacatgaacagaaccgatttcagttaatgact
gcaggaatcattaaacgtccagtaagcatagcaaaaaaaagttttgccacatcatctact
cagtttcttgagcatcaagatgctgtgaaaaaaatgcagattcatcggccctatgttgag
gtgttctctccctctcctcctaaactgccacatactggtattggaaaaagaggtctcttt
gggactagatcttcagcttaccctaagtacacttttcacgaccgagaagaagttgttaaa
gccaacattcgtgatcccttgcaaatcattaaaataatacgtgaaaatgaacatcttgga
tttctttatatgatccctgcagtgccaagatcatccattgaatatgatacatataatcta
aaagttgtaagttatgagaacatcaataaaaatgactactatactattagccaaagggca
gtaacacacatttataatgaagacattgaatttatcgaaattgatcgatgggaacaggaa
tatctgtatcacagagaactcactaagattcccatattttcactgttccggaaatggaag
gcttttagtgtatggaggaagaatgtccgctccaagaaaatcactggatgtcaaaaatct
ctacaaaaaaatttgttcattgttaatcctcatttgcgaccagctcttcttaaaataaat
gaattgtgttatcatttgagttttatgggactttgttatattgaaaagtgtcacacctac
accctgcaggaatttaaggccgcacaagtcatacggctagcagaggtgacagaacgccta
ggagaatttcgaaatgaggcaaaatatgtagtcaggagggcttgtcgatttgctttgcgt
gctgcaggatttgttcctgatgactgtgcatttggaccttttgaggattatcataaagtg
cagagcagtggaagtttcattaatacaccacatgagttgcccacttatggagactctgag
aaaatgacatatacagaacaggccagcaaaaggcattattgcatgaggctgacgtgcttt
attcgtctaaacgactatctaattgagaacacaatgcacatcttaacggtaaatgctgtt
aattcgcttttgaaccatctcactgacaagctaaaacgaacaccttcagcagatgtcatt
cagaaatggattactgaagagaagcctgaagtccctgataaaaaggggacccttatggtg
gaaaagcaagaagaagatgaatctctcatccccatgtttctcacagaactaatgttgaca
gtccagtcactgctctttgagccttctctggaagactttctggatggtattttgggtgca
gttaatcactgtcaaaacactgtgttatcagttcctaatctcgtgcctgattcgtatttt
gatgctttcaccagcccttatattaacaacaaacttgaaggaaaaacctgtggaactggg
ccaagtttagcagcagtatttgaggatgataagaattttcacacaattatttctcaaata
aaggaaaccattcaggccgcatttgaatcagcccgcatctatgcagctacctttgaaaag
ttccagatattcttcaaggaaaatgaaagtcttgatttacaagctcttaaacttcaggaa
cctgatattaacttttttagtgaacaactggaaaaatatcacaaacagcacaaggacgca
gtagcgctcagacccaccagaaatgtaggattgctgctcattgatactaggcttctaaga
gaaaaattaattccatcacctttgcgatgcttagaggtgctaaattttatgcttcctcgt
caaagcaagaaaaaagtggatgccattatctttgaggcacaagatgcagagtataaactt
gagtttgttccaactactaccacagaatatgttcatagcttattatttcttgatgaaatt
caggaacggattgaaagccttgaagatgaggggaatatagtgactcaaatgtacaagctt
atggaacaatatcaggtgcccacacctcctgaagactttgctgtttttgcaactatgaag
ccatccattgttgctgttcggaatgccattgataaatcagtgggtgatagagaatcaagc
attaagcaattttgtgtgcatttgggtagtgatcttgaagaattaaacaacgaagtgaat
gaagtaaaactgcaagcacaggatccacagattttagatatctctgctgaccaagacaaa
ataaggctcatattgaataatctgcaatctgttctggctgatcttcagaaacgtgcattt
cagtataagtcctatcagaagaattttaaggtagaagtgtccaagtttgaagctttggaa
gaagtcagtgctgaactgaagctcaaacaattgctctgggattctttctctgaatgggat
aaactccaacaagaatggttaaagtccaaatttgattgcctggatccagaagtcctaaac
ggtcaagtttctaaatatgctaaatttgtgactcaactggaaaaaggcttgccacccaac
agtgtagtgccccagctcaaatacaaggtggaaaaaatgaaagaaaagcttccagttatc
attgacttgaggaacccgactttgaaggcaagacattgggcagctattgaacaaacagtt
gatgccactctagtggatgctgaaattccattaaccttggagaggctctcccagttgcat
gtttttgactttggtcaagaaatccaggacatatctggacaggcttctggagaagctgcc
ttagaagcaattcttaaaaaggtggaggactcttggaaaacaactgaatttgtcattctg
cctcaccgtgactccaaagatgtgtttatactgggcggcacagatgacatacaggtcctt
cttgatgatagcaccatcaatgttgcaactcttgcctcatcacgttaccttggtccactg
aaaactcgagtggatgaatggcaaaaacaacttgctttatttaatcaaacactggaagag
tggctgacctgccagagaaactggctctacctagaaagtattttcaatgctccagacatt
cagaggcaattgcctgcagaggccaagatgttccttcaggtggataagtcatggaaagaa
atcatgagaaaggtgaatcggctgcctaatgctcttcgagccgctactcagccaggactt
ctggaaacttttcaaaacaataatgcattacttgaccaaattcagaagtgcctagaggca
tacttagaatcaaaaagagttatctttccaaggttttacttcttgtcaaatgatgaactt
ctggagattttggcccagacacgaaatccacaggccgtgcagccacacttaaggaaatgc
ttcgactccatttcaaagctcgaatttgctctcatgcctcctgccgaaggaaagattcct
ggtattgatggagaaccagaaaaggtttatactaatgatattttagcaatgctgtcacca
gagggagaaagggttagcttggggaaaggcctcaaggcccgaggcaatgtagaggaatgg
cttggtaaagtggaagaagccatgttcacatctctgcgtcgcctgtgcaaagctgccatc
gctgactatcaggggaaactgaggacagactgggtggttgctggccacccttctcaagtt
atcctgactgtttctcaaattatgtggtgccgtgatttgactgaatgtctggaaacagaa
cacagtaatcatatacaggccctgaagaattttgaaaaagtaaattttgagagattaaat
gccctagctgcaatagttcaaggcagtcttcctaaattacacagaaacatcctaactgca
ttgattactattgatgtgcatgcaagagatatagtcactgaacttgttcaatccaaggtg
gagacagttgaatcttttgactggcagagacaactgcgctattactgggatatagacctg
gataattgtgtggctagaatggcgctctctcagtacacttatggctatgaatatttgggt
gcatgcccaagattggttattactccactcacagatcgctgctatctttgcctcatggga
gctttgcagcttgaccttgggggtgcaccagctggtcctgctggcactgggaaaacagag
actaccaaagatctggcaaaagctcttgccatccagtgtgtggtctttaactgttcagat
ggtttggactacaagatgatggggcgcttcttcagtggcttggcacagtcaggggcctgg
tgctgctttgatgaatttaatcgaattgacatagaagttctgtccgtcatcgcgcagcaa
ctcattaccattaggaacgccaaagcggcaaagctctctagattcatgtttgaggggcgg
gaaataaagttggtgatgacttgtgcagccttcatcacaatgaatcctggctatgcaggg
agaactgaattgccagataatttgaaagccctgtttagaccatttgcgatgatggttcca
aattatgccttgattgcagaggtaattctatattctgaaggatttgaatccagtaaaata
ttagcaagaaaaatgactcagatgtataagctttgcagtgagcagctgtctcagcaggat
cactacgactttggcatgagagctgtgaagtctgtcctggtcatggctggatctttaaaa
agagaaaacccagacctaaatgaagatgtggtgttgataagagctttacaagactccaat
ttgccaaaatttctaacagatgatgctcttctgttcagtggaatcatatctgaccttttt
cctggagtccaaattccagaacatgattatggtattttacaatcaacaattgtggatgtc
atgaatagacaaaatcttcagcctgagatgtgtatggttagaaaggtgatacagttttat
gaaactatgctagtaaggcatggtgttatgttagtcgggccaacaggaggcggcaagacc
acagtttaccgaatactagcagaaactttagggaatttacaaaaacttgggatagaaaat
tccttttaccaagcagttaaaacatatgttctcaaccctaaatcaattaccatgggtgaa
ttatatggagaggttaataacttaaccttggaatggaaagatggtttgatggcactaagt
gtccgagcagctgtgaatgatacttcagaagaccataaatggatcatcagtgatgggcca
gtagatgctctttggattgaaaacatgaatacagtgctggatgataacaagatgctttgc
ctggctaacagtgagaggattaaactcacacctcaaattcacatgctttttgaggtgcaa
gatctgcgggttgcctcccctgcaacagtcagtcgatgtggaatggtgtttgtggatcct
gaagaactgaaatggatgccttatgttaaaacttggatgaagggtatttctaaaaaactg
actgaggaaacccaagaatatatattgaatcttttccaacgttatgttgatgaaggttta
cattttatcaataaaaagtgcagccaagcaattccacaagtggacatcagcaaagttact
acactctgttgcttattggagtccttgatacttgggaaagatggagttaacttggcaatg
gaacaaacaaaattgaacactatactatgtcagacttttgtattctgttatttgtggtct
ttgggtggaaacctaactgaaaactactatgattcttttgatacatttattagaacacaa
tttgatgataatcctgatgccaggcttcccaattctggtgatctgtggagcattcatatg
gactttgacaccaaacggctggatccctgggaacgaatcatacctactttcaaatacaac
cgagatgttccattttttgaaatgcttgtccccacaactgacacagtgcgctatgggtat
ctaatggaaaaactactggcagtcaagcattccgtgttgtttactggaataactggagtg
ggcaagtctgtgattgcaaaaggattgctaaataaaattcaagaatcagctggctatgtc
cctgtttatctaaatttttctgctcaaacttcatctgcaaggacacaagagatcattgag
tcaaaactggagagaaaaagaaaaaatattctaggagcaccgggaaacaaacgaattgtg
atttttgttgatgatttaaacatgcccagactggatcgctatggctctcagcctccgatt
gaattacttcggcagtatcaagattttgggggattttatgacagaaacaaactgttttgg
aaagaaatacaggatgtaacaatcatatcggcatgtgcacctccaggcggtggccgcaac
cctgtgactccccgcttcatcagacacttcagcatgctgtgcctcccaatgccctcagag
cacagtctgaaacagatttttcaggccatcttaaatggtttcctgagtgactttccacca
gctgtaaagcaaactgcatcaagcattgtagaagcctcagttgagatttataacaaaatg
agtgttgacctcctgccaacacccgccaagtcccattatgtctttaacttgagggactta
tccaaatgtgtgcaaggtatcctccaatgtgatccaggaacaataagagaagaaattcag
atatttagactcttttgccatgagtgccaaagggtcttccatgatcgcttgattaataat
gaagataagcactatttccatgttattctgacagaaatggccaacaaacattttggaatt
gcaattgacctggaatattttttgaataagcccatcatatttggagatttcattaagttt
ggagcagataaagctgatcggatttatgatgacatgcctgatatagagaaaactgcaaat
gttctacaggactatcttgatgattataatctcacaaatcccaaagaagtaaagttggtg
ttcttccaggatgctatagaacatgtttcaaggattgctcggatgatacgtcaagaaaga
ggcaatgccctgcttgttggagtaggaggcacaggaaagcagtcactcacgagacttgca
gctcatatatgcggttacaaatgtttgcagattgaactcagccggggatataattatgat
agttttcatgaagacctgaggaagttgtacaaaatggctggtgtagaagacaagaatatg
gttttccttttcactgacacccagattgtagtggaggagttcctagaagatataaataac
atcctgaactcaggtgaagtgcctaatttatttgaaaaggatgaactggagcaggtttta
gcggccaccagaccaagagcaaaagaagtaggaatttctgaggggaacagagacgaggtg
tttcaatactttatcagcaaagtgcgtcagaagctgcacattgttctctgcatgagccca
gttggggaggcctttcggtcccgatgcaggatgtttccatcccttgtgaattgctgcacc
attgactggtttgtgcagtggcccagagaagcacttctttctgtgtcaaagacatttttc
tcacaagtcgatgctggaaatgaagaactgaaagaaaagcttcccttgatgtgcgtgaac
gttcacttgagtgtctccagcatggcagagcgctattacaatgagctgcgcaggcggtac
tacacgacacccacctcctacctggagcttatcaatctttacctgtctatgctgtctgaa
aaaaggaagcagattatttcagcacgagatcgggtgaagaatggtctcaccaagctacta
gaaacaaacatactagtagataaaatgaaactagatctttcagctttagagcctgtactt
ttagcaaaatcagaagatgttgaagccctgatggaaaaattggcagtggatcaagaaagt
gccgatcaggtccgtaacactgtgcaggaggatgaagcaacagcaaaagtcaaagctgaa
gaaacccaagcaatagctgatgatgctcaaagagatcttgacgaggcactacctgcacta
gatgctgccaataaagcactggattccttagataaggcagatatatctgaaatcagagtt
tttacaaagcccccagatttggtcatgacagtaatggaagcaatctccattcttttgaat
gccaagcctgattggccatcagcaaagcaacttcttggtgactctaactttctaaaaagg
cttttagaatatgataaggagaacataaagcctcagatattggcaaagcttcaaaagtat
attaataatcctgattttgtgcctgaaaaagtggagaaagtgtccaaagcatgtaaatct
atgtgcatgtgggtaagagctatggatttgtactctcgagtggtcaaggtcgtcgaacca
aaaagacaaaagctccgcgccgcacaggctgaacttgacattaccatggctaccctgaga
gaaaagcaagcattactaagacaagtagaagatcaaatacaggccttacaagatgaatat
gacaaaggtgtaaatgaaaaagaaagcctggcaaagaccatggccctgacaaaagcacgt
ctagtacgtgctggaaagctgacagcagcattagaagatgagcaggttcgatgggaagaa
agcatacagaagtttgaggaagaaatatcaaatatcactgggaacgtgttcatagcagca
gcttgtgtggcctactatggggctttcacagcccagtacaggcagtcacttatagagtgt
tggatccaggactgtcagtctctggagatcccaatcgatccttccttcagtctcattaac
attcttggagatccctacgagatacggcagtggaacactgatgggctgccccgtgacttg
atatcaacagaaaatggcattttggttactcaaggcagaagatggcctttgatgattgat
ccccaagatcaggcaaaccgttggataaggaacaaggaaagcaaaagtggtttaaagatc
attaagcttacagatagtaatttcttacgaatactcgagaattcaatccgacttggttta
cctgtcttactggaagagcttaaggaaaccttggatccagctctagaacccattcttttg
aaacaaatttttatcagtggtggccgactactcatccgtcttggagactcagacattgat
tatgacaaaaactttaggttctatatgacaaccaaaatgccaaatccccactatctgcct
gaggtatgcattaaagttaccattatcaatttcactgtaacaaaatcaggcctggaggat
cagttgttaagtgatgtggtgcgacttgaaaaacccaggttggaagaacaaagaattaag
ctcatcgtgaggatcaacactgataaaaaccagttgaaaactatcgaagagaaaatcctg
agaatgctctttacctctgaaggaaatattctggacaatgaagaacttattgacacactc
caggattcaaagatcacttctggtgccattaaaaccaggctggaagaagcagagtccact
gagcagatgatcaatgtggctcgtgagaagtatcgtccagtggccactcaaggctctgta
atgtactttgtcattgcaagcctctcagaaatagatcctatgtaccagtactcattaaaa
tactttaaacagttgttcaataccaccattgaaacttctgtaaagacagaaaatctacaa
cagcgcctggacgtactactagaacaaactctcctaactgcttatgtcaatgtttcaaga
ggactttttgagcaacataaactcatctacagctttatgctttgtgttgagatgatgcgt
cagcaaggaaccctatctgatgctgaatggaatttctttctccgaggttctgcaggattg
gaaaaggaacgcccacctaagcctgaagctccctggctacctactgctacatggttcgca
tgctgtgacttggaagaatcatttccagtttttcacggacttacccaaaatatattgtca
catcctatttccatacgcttaggatcttttgagacttatattaacccacagaaatgggaa
ggctattctaaaatgaaacacgaagataaacacatgagacaggaaaaggaggcagcacac
caagatccatggagtgcaggattgagttctttccataagctaattcttattaaatgttgt
aaagaagaaaaggtggtttttgctcttacagactttgtgatagaaaatcttggaaaacag
tttatagagacaccacctgtggacctgcctaccctgtatcaagacatgtcatgcaacact
cccctggtattcatcctaagcacaggctcagatcccatgggtgcatttcagaggtttgcc
agggaaagtggatattcagaacgggtgcagtcaatttcactggggcaaggacaaggacct
attgctgaaaaaatggtcaaggatgcaatgaaatcaggaaactgggtatttttgcaaaat
tgccatcttgctgtttcttggatgttggcaatggaagagctcattaaaaccttcacagat
ccagatagtgctatcaaggacacttttcgactttttttaagctccatgcctagtaataca
tttcctgttacagttcttcaaaattctgtcaaggtgaccaatgagcctccaaaaggctta
cgtgcaaatatcagacgagcatttactgaaatgacaccttcgttttttgaagaaaatata
cttggaaaaaaatggagacaaataatatttggcatttgtttcttccatgcaattattcag
gagagaaagaagtttggcccccttggttggaatatctgctatgaatttaatgacagtgac
agggaatgtgctttactgaatctcaaactctattgtaaagaaggaaagattccctgggat
gcactaatttacattactggtgaaattacttatggtggtagagtcacagacagctgggac
caaagatgccttcgtactatcttgaaaagatttttttctcctgaaacattagaagaagat
tataaatactctgaatcaggcatctattttgcacccatggctgacagcctacaagagttt
aaggactacattgaaaatctgcctttgatcgatgacccagaaatttttggaatgcatgaa
aatgctaatctagtcttccagtacaaagagaccagcactttaatcaacaccatacttgag
gttcagccaaggtcatctactggtggagagggaaaaagcaatgacgaaattgttcaagaa
cttgttgcttctgtccagaccagagttccagaaaaactggaaatggagggtgcttctgag
agcctttttgtcaaggatcttcaaggacgtctgaactccttgaccaccgttcttggacag
gaagtggaccggtttaacaacctgctgaagttaattcatacttctctggaaacactcaac
aaagccatcgctggatttgtggtgatgtctgaagaaatggaaaaagtgtataacagtttc
ctcaacaaccaggttcccgctctgtggtccaacacagcctacccatccctgaagccacta
ggatcatgggtcaaagaccttatcctgaggacctcatttgtggatctgtggctcaaaaga
ggacagcctaagtcctactggatctctggtttcttctttcctcaaggatttctaacagga
actcttcaaaatcatgctcgaaaatacaatttgcctatagatgagctgagtttcaaatac
agcgtaattcccacctatcgggatcaagctgcagtgatagaagctgccaagacagtgcaa
tttggacaagaactgcccatggacatggagttgccctctcctgaggatggtgttcttgtt
catgggatgttcatggatgcttctcgatgggatgataaggagatggtgatagaagatgca
ttgcccggacagatgaatccagtgctgcctgtggtgcattttgaaccacaacaaaactat
aagccaagcccaacactttaccactgcccactttataaaacaggagcccgggcaggaaca
ctctcaaccacaggacattcaaccaattttgtggtaaccgtcctgttaccctccaagcgg
tccaaagactactggattgccaagggatcagctttgctctgccagctgagcgaatga

DBGET integrated database retrieval system