KEGG   Homo sapiens (human): 1769
Entry
1769              CDS       T01001                                 

Gene name
DNAH8, ATPase, hdhc9
Definition
(RefSeq) dynein axonemal heavy chain 8
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1769 (DNAH8)
   05016 Huntington disease
    1769 (DNAH8)
   05022 Pathways of neurodegeneration - multiple diseases
    1769 (DNAH8)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     1769 (DNAH8)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 Dynein_AAA_lid AAA_lid_1 AAA_16 AAA_33
Other DBs
NCBI-GeneID: 1769
NCBI-ProteinID: NP_001193856
OMIM: 603337
HGNC: 2952
Ensembl: ENSG00000124721
Vega: OTTHUMG00000016253
Pharos: Q96JB1(Tdark)
UniProt: Q96JB1 Q8IU65 A0A075B6F3
LinkDB
Position
6p21.2
AA seq 4707 aa
MEKDAEDGAPSEGAEAPPSTEEAAPPRSEEEEAPRPPTVEAPAEDGFSPSAEDAVSSVVD
YRDLIPSEEGIVLPDDHEADLNRVRQRLAPRPVQSVISEVLSLPSSRRSSRYRRSMSGLP
NLQETLKERQARFREARESRRLKIDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFT
NFFAKDGCKTLKFLYQEGDVPGIECGRTIAGATKGAKMMKLYIDNAAPDKLKGLCIFFVR
CRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGES
EKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLE
EVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVIN
VLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLI
NAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQD
CIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYS
TLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAF
MNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKD
DPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSDILSSPDGKAVIRQYNKISYVLVE
FEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVP
EQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVL
TWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVE
DMLTLNETYTKEWADILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFG
SETGEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKR
RIFVASLYGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAH
WGQQQIRPIKSVIPSPTTTDVTHQNTGKLLKKEERSFEEAIPARKLKNFYPGVAEHKDIS
KLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYA
TFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFIN
EYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESE
AVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVP
NIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYG
LYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFS
ESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICIS
AIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLS
NRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQN
IDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRF
FFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDN
SVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQML
WTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQR
DIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITP
LTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGR
IFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEF
GIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVL
YKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDED
EPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHG
LMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIF
STLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLF
EVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYT
YMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLE
LESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIP
EYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSL
NFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVR
QMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASI
DKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDL
SRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGS
DAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNE
IIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQ
ITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNL
FARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARS
LKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSES
CESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAK
LSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVK
AESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTM
DPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKV
CGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELD
KVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVG
DILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGL
QGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLE
DSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKL
PNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMK
ELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRP
AATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYE
VFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWI
LDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLL
LIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQ
IDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLIT
TEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNL
PMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVS
WNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQY
FEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYR
LSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAI
EGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPN
VFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGL
YMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKDPKLYVCPIYKKPRRTDLTF
ITVVYLRTVLSPDHWILRGVALLCDIK
NT seq 14124 nt   +upstreamnt  +downstreamnt
atggagaaggatgctgaagatggcgccccttctgagggagcagaggctcctccctctacg
gaagaggctgcccctccccgttcagaagaggaagaggccccgcgccctccgacagtggag
gccccggcagaagatggtttctctccttccgcagaagatgctgtttcttctgtggtggat
tatcgggatctcattccttctgaagaagggatagttcttccagatgatcatgaagcggat
ctgaatagagttcgacagaggcttgcaccgcgaccggttcagtcagtgatttcggaagtg
ctgtccttgccgtcttcccggaggtcctccagataccgccggagtatgagtggccttccc
aatctacaggaaacattaaaagagagacaggcaagatttagagaggcaagggaaagccga
agactgaaaattgacccttcatacaaatatatatttgaaattctagcagaaaatcttggc
ctggacatagtaactgttgaagaattaattttggattgcccatctctggaagcatttact
aatttttttgcgaaagatggttgtaagacactgaaatttttgtaccaagaaggagatgta
cctggtattgaatgtggtcgaactattgctggagcaactaaaggggcaaaaatgatgaaa
ttgtatatagacaatgcagccccggataaactaaaaggactgtgcatattttttgttcgt
tgccgtaatgatgttgctataaatgttaaaactattcaagaggaagcgctctttactgtt
ctggatgcgtcgaaaggactcttaaatggaattagggatatgttggcaaatatatttcta
ccagctgttcttgcaacaaacaactggggtgctttaaaccagtccaagcagggagaatct
gaaaaacatattttcactgaaaccatcaacagatatctttcatttttagatggtgctaga
ataagtattgagggaacagtgaagttaaagacaatagacaatgttaatttttccaaactg
cacacctttgaagaagtaactgctgcagccagcaactcagaaactgttcatcagctggag
gaagtgctgatggtatggtacaaacagatcgaacaggtacttattgagagtgagcagatg
agaaaagaagctggtgattcaggtccactcactgaattggaacactggaaacgcatgtca
gccaagttcaactatatcattgagcagattaaagggccaagttgtaaggctgtcataaat
gtgctaaatgttgcacactccaaactgctaaagaattggcgtgatttggatgcaagaatc
actgatacagcaaatgaatccaaagataatgtcagatatttgtatactttggaaaaagtg
tgtcaacctctctataaccatgacctagtttccatggcacatggaatacaaaatttgatt
aatgccatcagaatgattcacggtgtgtcaaggtattataatacctcagagagaatgacc
tcattgtttatcaaggtaacaaatcaaatggtaacagcatgtaaagcatatattactgat
ggaggattaaaccatgtatgggatcaggaaacgccagttgtactaaagaaaattcaggac
tgcatttttctattcaaggaatatcaggcatcttttcataaaacaaggaaactgatttca
gaatcctcaggggaaaaatcttttgaggtttcagaaatgtatatatttggaaaatttgaa
gctttttgcaaaagactggagaagattacagaaatgataactgttgtgcaaacatattca
accttgagtaattctaccatagaaggaatagatattatggcaataaaattcagaaatata
taccaaggggttaagaaaaagcaatatgacattctggatccaagaaggacagaatttgac
acagatttcttagatttcatgacaaaaatcaatggtttagaggtacaaatacaggcattt
atgaacagtagttttgggaaaatcttatcttctcagcaggctcttcagctacttcaaagg
tttcagaagctgaacattccctgtctgggattagaaataaaccacacaatagagcgtatt
cttcagtactatgtggctgaacttgatgctactaagaagctttatcattctcagaaagat
gacccccctcttgctcgcaacatgccccctatagcaggaaaaatactctgggtgaggcag
ctctatcgccggataagtgagcccatcaattatttctttaaaaactcagacattttatca
agtccggacggtaaagctgtcatccgtcagtataacaagatctcctatgtgctggtggaa
ttcgaggtggtctatcacacagcctggatcagagagatttcacagttgcattacgcttta
caagccacgctttttgtgcgacatccagaaacagggaagttgctggttaatttcgatccc
aaaattttggaagttgttcgggaaactaagtgtatgataaaaatgaagttggatgtacca
gaacaggcaaagagattgctaaaattggaaagtaaattgaaagcagacaaactgtatttg
cagggtcttctgcaatattatgatgagttatgtcaggaagtgccttctgtgtttgtcaat
ctgatgaccccaaaaatgaaaaaggtggaatctgtgttgaggcaaggactcacagtgtta
acatggtcgtctttaacactggaaagcttctttcaagaagtcgaattagttttggatatg
ttcaatcaacttttaaagaagatcagtgacttgtgtgaaatgcatattgatacagttctg
aaggagatagccaaaactgtgttgatttctctgcctgaaagtggtgctaccaaagtagaa
gatatgttgaccctcaatgagacatacacaaaagaatgggctgacattctaaaccacaaa
agtaagcatgtggaagaagctgtcagagaacttatatcaatatttgagcagatttatgaa
gtgaaatacactgggaaagtaggaaaacagtcagaacagcggaaacacgttgtttttgga
agtgaaacaggagagggtgaaaacaatgactatgaagctaatattgtgaatgagtttgat
actcatgataaagaagatgaatttaaaaaggagtgtaaagaggtctttgcttttttctct
catcaattactagacagtcttcaaaaagctacacggttatctctggacacaatgaaaaga
agaatatttgttgcaagcctttatgggcgaaagcagtcagaagatattatttcctttata
aaaagtgaagtacatcttgcaattcctaatgtggtgatgattcctagtttggatgacatt
caacaagccattaaccgtatgatccagttaaccctggaggtcagcagaggagtggctcac
tgggggcaacagcaaatccgtcccatcaagtctgtcattcccagccccaccactactgac
gtgacccatcaaaacacaggaaaactgctgaagaaggaagaaagatcttttgaagaagct
attcctgcgaggaagctgaagaatttttacccgggggtagcggagcacaaggatatttct
aagttggtcctgctcctttcttcctctgtaaattccctaagaaaggcagctcatgaggcc
ctgcaggactttcagaagtacaagactctctggacagaggaccgcgatgtgaaagtgaag
gaatttttggctaacaacccctctctgactgaaatcagatcagaaattctacactatgct
acttttgaacaggagattgatgagttgaagcctattattgttgtaggagcacttgaatta
catacagagccgatgaaattggccttatccatcgaggccaaggcatggaagatgttactc
tgtcgatatctgaatgaagaatacaaaaagaaaatgtcatacatgatagcatttattaat
gaatacttgaaaaagttatctagacctattcgtgatttagatgatgtcagatttgcaatg
gaagccttgtcttgcatacgtgataatgaaattcaaatggacatgactttgggaccaatt
gaagaagcctatgctattttaaacagatttgaagttgaagtaaccaaagaagaatcagaa
gcagttgataccttaagatattctttcaacaaattgcagagcaaagctgtttcagtacaa
gaggacctagttcaagtgcagccaaagtttaaaagcaatctacttgagtctgtggaagtt
tttcgtgaggacgtgataaactttgcagaagcatatgaattggaaggacctatggttcca
aatataccaccccaagaagctagcaacaggctacagatatttcaggccagtttcgatgat
ctgtggaggaaatttgttacgtattcatctggtgaacaactttttggattgcctgtgact
gattatgaggttttacacaaaaccagaaaagaactcaacttgctgcagaagctgtatgga
ttgtatgacaccgtaatgagcagtattagtggttattatgaaatactttggggagatgta
gatattgaaaaaattaatgcagaactgctggaatttcaaaacagatgtcgtaaacttcca
aaaggacttaaagattggcaagcttttttggatctcaaaaagagaattgatgatttcagt
gagtcatgtcctctactggaaatgatgaccaataaggccatgaaacagagacactgggat
agaatctccgagttaactggaaccccatttgatgtggaatctgattctttttgccttaga
aatatcatggaagcaccactccttaaacataaggatgatattgaggatatttgcatatct
gccattaaggagaaggatatcgaagccaagctgactcaggtgattgagaattggaccaac
caaaatctgagttttgcagcatttaagggaaaaggagagctcctgctcaaaggaaccgaa
tcgggagaaattatcactttgatggaggatagtttaatggtcttagggtctttactcagc
aacagatacaatgctccatttaaaaaaaatatccagaattgggtgtataaattgtccact
tcctcagatataattgaagagtggctcgtagtacagaacctttgggtttatcttgaagcc
gtctttgtaggtggagatattgccaaacagctgcctcaggaagcaaaacgttttcagaat
attgacaagtcttggataaaaataatgcagcgagctcatgagaatcccaatgtgattaat
tgctgtgttggagatgaaaccatgggacaacttttacctcatttacatgagcagttggaa
gtatgtcagaagtcactcacagggtatttggagaagaaacgattactgtttccaagattc
ttctttgtatctgatccagttctcctggaaattcttggacaagccagtgattcccacacc
atacagccgcatctccctgcagtatctgacaacatcaatgaggtgacatttcatgcaaaa
gactatgatcgcatcatggccgtcatatcaagagaaggagaaaaaattgttttggataat
tctgttatggccaaaggtcctgtggagatttggctactggatttgttaaaaatgcagatg
tcatcattacataatataattagatccgctttctatcaaatcagtgattcaggatttcaa
ctcttaccattcctcagccactttccagcacaggttggacttctgggaattcagatgttg
tggacacacgattcagaagaggctttacgtaatgcaaaagatgacaggaaaatcatgcaa
gtgaccaatcagaaatttttggatattctaaatactctcattagtcagacaacacatgat
ctaagcaagtttgatagagtgaagttcgagactctaattaccatccatgtgcatcagaga
gatatttttgatgacttggtaaaaatgcatatcaaatcacctactgactttgaatggcta
aaacagagtagattttattttaaggaagatttggatcaaactgtggtgtctattacagat
gttgattttatttaccaaaatgaatttctgggatgtactgatcgtcttgttatcactcca
ttaacagatagatgctatatcacgttagctcaggccttgggcatgaacatgggaggtgct
cccgcaggacctgctggcactggcaaaacagaaaccacaaaagacatgggaaggtgtttg
ggaaaatatgtggtcgtgttcaattgctcagatcaaatggatttcagaggcctaggaagg
attttcaaaggtcttgcacagtcgggttcctggggctgttttgatgagtttaacagaatt
gaattgcctgtattatcagtggcagcacaacaaatttatattgttttgacagcaagaaaa
gaaagaaagaaacagttcattttttctgatggtgattgtgttgatttaaatccagaattt
ggaatcttcttaacgatgaaccctggatatgctgggcgccaggaactaccagaaaaccta
aaaatccagtttagaactgttgctatgatggttcctgatagacagatcattatgagagtt
aaacttgcaagctgtggttttcttgaaaatgttatcttggctcaaaaattttacgttctt
tacaaactctgtgaagagcaacttactaaacaggttcattatgactttggattgagaaat
attctgtctgtattgaggactcttggatctcaaaaaagagccagaccagaagatagtgaa
ttaagcattgtcatgagaggactaagagatatgaacctttccaaactggttgatgaagat
gaacccctgttcctcagcttaatcaatgacctgttcccaggactgcaactggatagtaat
acttatgcagaactgcaaaacgcagtagcccatcaggttcagatagagggtttgattaac
catccaccctggaacctgaaactcgtgcagttatatgagacgtctttggtacggcatggc
ttgatgactcttgggcccagtggttctggaaagacaaccgttatcacgattctaatgaag
gcgcaaacagaatgcggaaggcctcatagagaaatgcgaatgaatccaaaagccattact
gcacctcagatgtttggcagactggacactgctaccaatgactggacagatgggattttt
tctactctgtggagaaaaacattaaaagctaaaaaaggtgaaaacattttcctcatttta
gatggtcctgtggatgccatctggattgagaacttaaattccgttttggatgacaataaa
actctgacgttagctaatggagatcgcattcccatggcccctagttgtaagcttctgttt
gaagtccacaatatcgagaacgcctctcctgccacggtttctaggatgggcatggtctat
atcagcagctctgctctcagctggaggccaatcttacaggcatggttgaagaaacgcact
gcacaggaagctgctgtattcctgacactgtatgagaaagtctttgaagatacatacaca
tatatgaagctaaatctcaatcccaaaatgcagctcttggagtgcaactatattgtgcaa
tctctcaatcttctggaagggttaattccctccaaagaagaaggcggtgtttcctgtgtc
gaacatcttcataaattatttgtgtttggcctaatgtggagtttaggagcccttctggaa
ttagaaagcagagaaaagcttgaagccttcttacggcagcatgaaagcaagttggactta
ccagaaatacctaaaggctcaaatcaaaccatgtatgagttttatgttactgattatggt
gattgggagcactggaataagaaacttcagccttattattatccaactgacagtattccg
gaatattcatcaattttggttccaaatgttgacaatattagaacaaattttttgatagac
accattgcaaaacaacataaagctgttttgctcacaggagagcagggaactgcaaaaact
gtcatggttaaggcctatttgaaaaaatatgatcctgaagtacagctatccaaaagtcta
aacttttcatctgccacagaaccaatgatgtttcagagaacaattgaaagctacgtggat
aagcgaattggaagcacatatgggccaccaggagggagaaaaatgactgtatttattgat
gatattaatatgcctgtgattaatgagtggggagatcagataactaatgagattgtgcga
cagatgatggaaatggaaggaatgtacagcttggacaagcctggagacttcactactatt
gttgatgtgcagctcatagcagcaatgatccaccctggaggtggtcgaaatgatattcca
caacgtttaaaaagacaatttactgtgtttaattgtacattgccttcaaatgcttcaata
gacaaaatttttggaattattggatgtggatactttgatccttgtagaagtttcaagcct
caaatatgtgagatgattgtgaatttagtctcagtgggtagagtgctgtggcaatggact
aaggtgaagatgctgccaactccttctaaatttcattacatcttcaatcttcgagatctt
tccagaatttggcaaggaatgttgaccataaaagctgaggagtgcgcttcaatccctact
ctcctgtcccttttcaaacacgagtgcagcagagtaattgcagacagatttataactcct
gaagatgagcagtggtttaatgcacatcttactcgtgcagttgaagaaaatattggctct
gatgcagcgtcgtgtattcttcctgaaccatactttgtggattttcttcgtgagatgcca
gaaccaactggtgatgaacctgaagactctgtgtttgaagtacccaaaatatatgaattg
atgccatcctttgactttctggctgaaaaactccagttttaccagagacagttcaatgaa
atcattagaggaacatctcttgatctggtgttttttaaagatgcaatgactcatcttatt
aagatttcacgaataattcgaacgtcgtgtggaaatgcattgctggtgggtgttggtggt
tccggaaaacaaagtctttcaagattggcctcttttattgctggctatcaaatattccag
ataacattaaccaggtcttacaatgtgactaatctaacagatgatttaaaagctttgtac
aaagttgctggtgctgatggaaaaggcatcactttcatctttactgacagtgaaataaaa
gatgaggcatttctagaataccttaacaacttgctatcttcaggggagatctccaacttg
tttgcacgagatgagatggatgaaatcacccaaggtctgatttcagtgatgaagagggag
ctacctcgccatcctcctacctttgataatttgtatgaatacttcatttcaagatcaagg
aagaacttacatgttgttctctgcttttctccagttggtgagaagttccgtgcccgttct
ttgaaatttcctggcttgatatcaggttgcactatggactggttcagccgctggccaagg
gaggctctgattgctgtggcctcctacttcctttcagactataatattgtctgctctagt
gaaattaaaagacaagttgtagaaacaatgggcctgtttcatgacatggtttcagagagc
tgtgaaagttatttccaaagataccgccgaagagcacatgtgactcccaaatcttacctc
tcatttataaatggttataaaaacatttatgctgaaaaggtgaagttcattaatgaacag
gctgaacgtatgaatattggtcttgataaactaatggaggcaagtgaatctgttgctaaa
ctctctcaggatcttgcagtcaaggagaaggagttggcagtggcttccataaaagcagac
gaagtattagcagaagtcacagtaagcgctcaggcttcagccaaaattaaaaatgaagta
caggaggtaaaggacaaagcccaaaaaattgtggatgaaattgatagtgaaaaagtgaaa
gctgaaagcaagcttgaggcagctaaacctgcactggaagaagcagaagcagccctgaat
actatcaagccaaatgatattgccacagtcaggaaacttgcaaaaccaccacatcttatt
atgagaatcatggactgtgttctgttactatttcaaaagaaaattgaccctgttactatg
gatccagaaaaatcttgctgtaagccatcatggggagagtcattaaagttgatgagtgca
acaggattcctgtggagccttcagcagttccctaaggacactataaatgaagagactgtt
gagttactacagccatattttaatatggatgattatacttttgaaagtgccaaaaaagtc
tgtgggaatgtggctggtctcctgtcttggacacttgctatggcaatattttatggcatc
aatagagaagtgttgcctctgaaggccaacctggccaagcaggaaggccggttagcagtt
gctaatgctgagttagggaaggcacaagccctgctggatgagaagcaagctgagctggat
aaagtacaggcaaaatttgatgcagcaatgaatgagaaaatggatttgcttaatgacgct
gatacgtgccggaaaaagatgcaggccgcctccactctcatcgatgggctgagtggagaa
aaaatccggtggacccagcaaagtaaagaattcaaagctcagattaatagacttgtaggt
gatattctgctgtgcacgggattcctttcctaccttggtcctttcaatcagatatttagg
aactatttgcttaaagatcaatgggaaatggagttgagagcacggaaaattcctttcaca
gaaaacctgaatcttatttcaatgttggtggatcctccaactattggtgagtgggggcta
cagggattaccaggagatgatctctcaattcagaatggcattattgtgacaaaggccacc
agatacccactcctcatagacccacaaactcaaggcaaaacttggattaaatcaaaggaa
aaagaaaatgatttacaggtgacatctctgaaccataaatattttcgcacacacttggag
gacagcctttccttgggccgaccccttctcattgaggacattcatgaagagctggatcca
gccttggataatgtattagaaaagaattttattaaatctggcaccactttcaaggtgaaa
gtcggtgataaggaatgtgatatcatggatacatttaaactttacattactacgaagtta
ccaaatcctgcctttaccccagagattaatgctaaaacgtcagtcattgatttcactgtt
acaatgaaaggacttgagaatcagttactaaggagagtcattctaacagagaaacaggag
ttagaggctgagagggttaaacttttggaggatgttacttttaataagcggaagatgaaa
gaacttgaagataacctcctctataaattaagtgctacaaaaggctcattggtagatgac
gaatctctcattggtgtacttcgaactaccaagcagacagcagctgaggtaagtgaaaag
ttgcatgtggctgcagaaactgagatcaagatcaacgcggctcaggaggagttccggccc
gcagccacccgcggaagcatcctctacttcctcatcacagagatgagcatggtcaacatc
atgtatcagacgtcattggcccagttcttgaagttatttgaccagtccatggccagatct
gaaaagtcaccactacctcaaaagagaattacaaatattatcgagtacctgacatatgaa
gtttttacatactctgtcagaggcctatacgaaaaccacaaattcctgtttgtactcctc
atgaccttaaagattgaccttcagagagggacagttaagcacagagagtttcaagctctc
attaaagggggagcagctctggacctgaaagcctgtcctcccaaaccctatcgctggatc
cttgacatgacttggctgaatcttgtggagctgagtaaacttccacaatttgcagaaatt
atgaaccagatatctcgtaatgagaaggggtggaaaagctggtttgataaagatgctcca
gaggaggaaattatccctgatggatataatgattcactagatacctgccataaactttta
cttatcaggtcttggtgcccagaccgtactgtttttcaagcaagaaagtatattgcagat
tctttggaggagaagtacacagaaccagttatcttaaatctggagaaaacttgggaagaa
agtgatacccggacacctctgatatgcttcctgtccatgggatctgaccccaccaatcaa
attgatgcattggccaagaaactgaaactggaatgtagaactatctcaatggggcaagga
caagaagtacatgctcgaaagctgattcagatgtcaatgcagcagggtggttgggtatta
ctacaaaattgccaccttggcctggaattcatggaagaattactagagacgctaattacc
actgaagccagtgatgattctttccgagtatggataactacggagccccatgatcgattt
ccaattacattgcttcagacctctctcaaattcactaatgagccaccccaaggtgtacgc
gcaggtttgaaaagaacatttgctggaattaatcaagaccttctggacatcagtaattta
cccatgtggaagccgatgctttacacagtagcatttttacactccactgtgcaggagcga
cgaaaatttggccccttaggatggaatattccctacgaattcaattctgctgacttttca
gccagtgttcagtttattcagaatcaccttgatgaatgcgatattaagaaaggtgtatca
tggaatacggttcggtacatgatcggagaagtacaatatggaggcagagtgacagatgac
tttgacaaacgtctacttaattgctttgccagagtctggttcagtgagaagatgtttgaa
ccgtcattctgcttttatactggatataaaatccccttatgcaaaaccttagaccagtat
tttgaatacatccagtcactgccatccctagataaccctgaagtctttgggcttcaccct
aatgctgatatcacgtatcagagtaacactgcttctgctgttcttgaaacaattaccaac
attcaacccaaagagagtggaggtggtgtgggagagacccgggaggctattgtttataga
ttatctgaagatatgctgagtaaactccctcctgattacattcctcatgaggtgaaatct
cgtttgataaagatgggccatcttaattcaatgaacatatttcttagacaagaaattgac
agaatgcaaagagtcatttcaatactccgcagtagcctgagtgatctaaaattggccatt
gaaggaacaatcattatgagtgagaatctgagagatgctctggacaacatgtatgatgct
cgtatacctcagctctggaaaagagtgtcttgggattcgtccacactgggcttctggttc
actgaacttttggaaagaaatgctcagttttctacgtggatatttgaagggaggcctaat
gtgttttggatgactggtttctttaatccccaaggcttcctcacagcaatgaggcaagaa
gtgacccgtgcccacaaaggctgggcactggacactgtgaccatccacaatgaagttctg
agacagaccaaggaggagatcacgtcaccccctggggaaggtgtgtatatttatgggctc
tacatggatggagcagcctgggacagacggaatgggaagctcatggaatccacccccaag
gtactcttcacgcagttacccgtgctccacatctttgccattaactccacggcacccaag
gaccccaagctgtatgtgtgtcctatttacaagaaacccaggcgaactgatttgaccttc
atcactgtggtatatttacgaacagtgttgtccccggatcactggatcctgagaggagtg
gcccttttgtgtgacatcaagtaa

DBGET integrated database retrieval system