KEGG   Homo sapiens (human): 1788Help
Entry
1788              CDS       T01001                                 

Gene name
DNMT3A, DNMT3A2, M.HsaIIIA, TBRS
Definition
(RefSeq) DNA methyltransferase 3 alpha
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
hsa05206  MicroRNAs in cancer
Module
hsa_M00035  Methionine degradation
Disease
H01481  Myelodysplastic syndrome
H01892  Peripheral T cell lymphoma
H02294  Tatton-Brown-Rahman syndrome
Drug target
Azacitidine: D03021
Decitabine: D03665
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    1788 (DNMT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1788 (DNMT3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    1788 (DNMT3A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1788 (DNMT3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     1788 (DNMT3A)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    1788 (DNMT3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    1788 (DNMT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 1788
NCBI-ProteinID: NP_072046
OMIM: 602769
HGNC: 2978
Ensembl: ENSG00000119772
Vega: OTTHUMG00000094777
Pharos: Q9Y6K1(Tclin)
UniProt: Q9Y6K1
LinkDB All DBs
Structure
PDB: 

Position
2p23.3
AA seq 912 aa AA seqDB search
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV
ESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEG
AAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSL
RQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVE
EASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYN
KQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLV
YEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTIC
CGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRED
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRY
IASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPAR
KGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMI
DAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLKEYFACV
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccatgccctccagcggccccggggacaccagcagctctgctgcggagcgggag
gaggaccgaaaggacggagaggagcaggaggagccgcgtggcaaggaggagcgccaagag
cccagcaccacggcacggaaggtggggcggcctgggaggaagcgcaagcaccccccggtg
gaaagcggtgacacgccaaaggaccctgcggtgatctccaagtccccatccatggcccag
gactcaggcgcctcagagctattacccaatggggacttggagaagcggagtgagccccag
ccagaggaggggagccctgctggggggcagaagggcggggccccagcagagggagagggt
gcagctgagaccctgcctgaagcctcaagagcagtggaaaatggctgctgcacccccaag
gagggccgaggagcccctgcagaagcgggcaaagaacagaaggagaccaacatcgaatcc
atgaaaatggagggctcccggggccggctgcggggtggcttgggctgggagtccagcctc
cgtcagcggcccatgccgaggctcaccttccaggcgggggacccctactacatcagcaag
cgcaagcgggacgagtggctggcacgctggaaaagggaggctgagaagaaagccaaggtc
attgcaggaatgaatgctgtggaagaaaaccaggggcccggggagtctcagaaggtggag
gaggccagccctcctgctgtgcagcagcccactgaccccgcatcccccactgtggctacc
acgcctgagcccgtggggtccgatgctggggacaagaatgccaccaaagcaggcgatgac
gagccagagtacgaggacggccggggctttggcattggggagctggtgtgggggaaactg
cggggcttctcctggtggccaggccgcattgtgtcttggtggatgacgggccggagccga
gcagctgaaggcacccgctgggtcatgtggttcggagacggcaaattctcagtggtgtgt
gttgagaagctgatgccgctgagctcgttttgcagtgcgttccaccaggccacgtacaac
aagcagcccatgtaccgcaaagccatctacgaggtcctgcaggtggccagcagccgcgcg
gggaagctgttcccggtgtgccacgacagcgatgagagtgacactgccaaggccgtggag
gtgcagaacaagcccatgattgaatgggccctggggggcttccagccttctggccctaag
ggcctggagccaccagaagaagagaagaatccctacaaagaagtgtacacggacatgtgg
gtggaacctgaggcagctgcctacgcaccacctccaccagccaaaaagccccggaagagc
acagcggagaagcccaaggtcaaggagattattgatgagcgcacaagagagcggctggtg
tacgaggtgcggcagaagtgccggaacattgaggacatctgcatctcctgtgggagcctc
aatgttaccctggaacaccccctcttcgttggaggaatgtgccaaaactgcaagaactgc
tttctggagtgtgcgtaccagtacgacgacgacggctaccagtcctactgcaccatctgc
tgtgggggccgtgaggtgctcatgtgcggaaacaacaactgctgcaggtgcttttgcgtg
gagtgtgtggacctcttggtggggccgggggctgcccaggcagccattaaggaagacccc
tggaactgctacatgtgcgggcacaagggtacctacgggctgctgcggcggcgagaggac
tggccctcccggctccagatgttcttcgctaataaccacgaccaggaatttgaccctcca
aaggtttacccacctgtcccagctgagaagaggaagcccatccgggtgctgtctctcttt
gatggaatcgctacagggctcctggtgctgaaggacttgggcattcaggtggaccgctac
attgcctcggaggtgtgtgaggactccatcacggtgggcatggtgcggcaccaggggaag
atcatgtacgtcggggacgtccgcagcgtcacacagaagcatatccaggagtggggccca
ttcgatctggtgattgggggcagtccctgcaatgacctctccatcgtcaaccctgctcgc
aagggcctctacgagggcactggccggctcttctttgagttctaccgcctcctgcatgat
gcgcggcccaaggagggagatgatcgccccttcttctggctctttgagaatgtggtggcc
atgggcgttagtgacaagagggacatctcgcgatttctcgagtccaaccctgtgatgatt
gatgccaaagaagtgtcagctgcacacagggcccgctacttctggggtaaccttcccggt
atgaacaggccgttggcatccactgtgaatgataagctggagctgcaggagtgtctggag
catggcaggatagccaagttcagcaaagtgaggaccattactacgaggtcaaactccata
aagcagggcaaagaccagcattttcctgtcttcatgaatgagaaagaggacatcttatgg
tgcactgaaatggaaagggtatttggtttcccagtccactatactgacgtctccaacatg
agccgcttggcgaggcagagactgctgggccggtcatggagcgtgccagtcatccgccac
ctcttcgctccgctgaaggagtattttgcgtgtgtgtaa

DBGET integrated database retrieval system