KEGG   Homo sapiens (human): 1791Help
Entry
1791              CDS       T01001                                 

Gene name
DNTT, TDT
Definition
(RefSeq) DNA nucleotidylexotransferase
  KO
K00977  DNA nucleotidylexotransferase [EC:2.7.7.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03450  Non-homologous end-joining
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    1791 (DNTT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1791 (DNTT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1791 (DNTT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.31  DNA nucleotidylexotransferase
     1791 (DNTT)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     1791 (DNTT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_thumb DNA_pol_lambd_f DNA_pol_B_palm HHH_8 BRCT NTP_transf_2 BRCT_2 LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 1791
NCBI-ProteinID: NP_004079
OMIM: 187410
HGNC: 2983
Ensembl: ENSG00000107447
Vega: OTTHUMG00000018832
Pharos: P04053(Tchem)
UniProt: P04053
LinkDB All DBs
Structure
PDB: 

Position
10q24.1
AA seq 509 aa AA seqDB search
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG
FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT
GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE
FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV
SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL
LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT
KRIFLKAESEEEIFAHLGLDYIEPWERNA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccacgagcgtcccacttgagccctcggaagaagagaccccggcagacgggt
gccttgatggcctcctctcctcaagacatcaaatttcaagatttggtcgtcttcattttg
gagaagaaaatgggaaccacccgcagagcgttcctcatggagctggcccgcaggaaaggg
ttcagggttgaaaatgagctcagtgattctgtcacccacatcgtagcagagaacaactcg
ggttcggatgttctggagtggcttcaagcacagaaagtacaagtcagctcacaaccagag
ctcctcgatgtctcctggctgatcgaatgcataagagcagggaaaccggtggaaatgaca
ggaaaacaccagcttgttgtgagaagagactattcagatagcaccaacccaggccccccg
aagactccaccaattgctgtacaaaagatctcccagtatgcgtgtcagagaagaaccact
ttaaacaactgtaaccagatattcacggatgcctttgatatactggctgaaaactgtgag
tttagagaaaatgaagactcctgtgtgacatttatgagagcagcttctgtattgaaatct
ctgccattcacaatcatcagtatgaaggacacagaaggaattccctgcctggggtccaag
gtgaagggtatcatagaggagattattgaagatggagaaagttctgaagttaaagctgtg
ttaaatgatgaacgatatcaatccttcaaactctttacttctgtatttggagtggggctg
aagacttctgagaagtggttcaggatgggtttcagaactctgagtaaagtaaggtcggac
aaaagcctgaaatttacacgaatgcagaaagcaggatttctgtattatgaagaccttgtc
agctgtgtgaccagggcagaagcagaggccgtcagtgtgctggttaaagaggctgtctgg
gcatttcttccggatgctttcgtcaccatgacaggagggttccggaggggtaagaagatg
gggcatgatgtagattttttaattaccagcccaggatcaacagaggatgaagagcaactt
ttacagaaagtgatgaacttatgggaaaagaagggattacttttatattatgaccttgtg
gagtcaacatttgaaaagctcaggttgcctagcaggaaggttgatgctttggatcatttt
caaaagtgctttctgattttcaaattgcctcgtcaaagagtggacagtgaccagtccagc
tggcaggaaggaaagacctggaaggccatccgtgtggatttagttctgtgcccctacgag
cgtcgtgcctttgccctgttgggatggactggctcccggcagtttgagagagacctccgg
cgctatgccacacatgagcggaagatgattctggataaccatgctttatatgacaagacc
aagaggatattcctcaaagcagaaagtgaagaagaaatttttgcgcatctgggattggat
tatattgaaccgtgggaaagaaatgcctag

DBGET integrated database retrieval system