KEGG   Homo sapiens (human): 1794Help
Entry
1794              CDS       T01001                                 

Gene name
DOCK2, IMD40
Definition
(RefSeq) dedicator of cytokinesis 2
  KO
K12367  dedicator of cytokinesis protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
Disease
H00093  Combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    1794 (DOCK2)
   04062 Chemokine signaling pathway
    1794 (DOCK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1794 (DOCK2)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    1794 (DOCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_9 SH3_2 SH3_1 DUF1539
Motif
Other DBs
NCBI-GeneID: 1794
NCBI-ProteinID: NP_004937
OMIM: 603122
HGNC: 2988
Ensembl: ENSG00000134516
Vega: OTTHUMG00000130437
Pharos: Q92608(Tbio)
UniProt: Q92608 Q5XG91
LinkDB All DBs
Structure
PDB: 

Position
5q35.1
AA seq 1830 aa AA seqDB search
MAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFP
KSFIHIKEVTVEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDNTSV
ISLFHAHEEATDKITERIKEEMSKDQPDYAMYSRISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIV
RVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFL
HSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLHDGFHDLVVLKGDSKKMEDASAYLTLPSYRHHVENKGATLSRSSSSVGGLSVSSRDVF
SISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHSQSDEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQKDDMQHQVLERKYCVELLNSILEVLSYQD
AAFTYHHIQEIMVQLLRTVNRTVITMGRDHILISHFVACMTAILNQMGDQHYSFYIETFQ
TSSELVDFLMETFIMFKDLIGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTN
FEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQN
KICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEV
EGGRGDEQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRGVMTDESKDNR
MSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS
QVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQ
NLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMT
QFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQ
RFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIE
TMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHP
EDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
EMPDFDDRRVGRPRSMLRSYRQMSIISLASMNSDCSTPSKPTSESFDLELASPKTPRVEQ
EEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAA
IPLKASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTR
KKVNQFFKTMLASKSAEEGKQIPDSLSTDL
NT seq 5493 nt NT seq  +upstreamnt  +downstreamnt
atggccccctggcgcaaagctgacaaggagcggcacggcgtggccatatacaacttccaa
ggcagcggagccccccagctctccctgcagatcggcgatgtggtgcgaatacaggagacg
tgtggagactggtataggggatacctcataaagcacaaaatgttacagggcatttttcct
aagtcatttatccacatcaaggaagtgacagttgagaaaagaagaaatactgagaacatc
attcctgcagaaattcctctggcacaagaagtgacaacgacactttgggaatggggaagc
atctggaaacaactctatgtggccagcaaaaaggagcgttttctccaggtgcagtccatg
atgtacgatctgatggagtggaggtcccagcttctctcaggaaccttacccaaggatgag
ctgaaggaactgaagcagaaagtcacgtccaaaattgactatggcaacaaaatccttgag
cttgatttgattgtcagagatgaagacggaaatatcttggaccctgataataccagtgtc
atcagcttgttccatgcacatgaggaagcaactgataaaatcacagagcgtatcaaagaa
gaaatgtcaaaagaccagccagattatgcaatgtattcccggatctcctcatcccccacc
catagcctctatgtgtttgtgagaaactttgtgtgcagaattggggaagatgctgagctc
ttcatgtctctctacgaccccaacaagcaaacggtcataagtgagaactacctagtgcga
tggggcagccggggcttccctaaggagattgagatgctcaacaatctgaaggtggtcttc
acggatcttggaaacaaagacctcaacagggataaaatttacttgatttgtcaaatagtc
cgggtcggcaagatggatcttaaggatactggtgcaaagaagtgcacgcagggactgagg
aggccctttggggtggcagttatggatataacagacatcatcaaggggaaagcagagagt
gatgaagaaaagcagcacttcattccttttcacccggttacagctgagaatgacttccta
cacagcctgctgggcaaagtcatagcctccaagggggacagtggagggcaaggcctctgg
gtgaccatgaagatgctggtgggtgacatcattcagattcgcaaggactatccacacctg
gtggacaggaccaccgtggtggccaggaagctgggattcccagagatcatcatgccaggg
gatgtcaggaacgacatctacattactctcttacaaggtgactttgacaagtacaacaag
accacacagaggaatgtggaagtcatcatgtgtgtgtgcgcggaggatggcaaaacgctg
cctaatgcaatttgcgtgggagcaggggacaagcccatgaatgagtatcgctccgttgtg
tactatcaagtcaaacagccacgctggatggaaacagtcaaggtggctgtccctattgaa
gacatgcagaggatccatctgcgattcatgtttcgacatcggtcatctctggaatctaaa
gataaaggagaaaagaactttgccatgtcctatgtgaagctgatgaaagaagatgggact
actctacacgatggattccatgacttagttgtcctcaagggggacagcaagaagatggag
gatgccagcgcatacctgacccttccttcttatcgacaccatgtggaaaacaagggggcc
acgctgagcaggagctccagcagtgttggggggctttctgtcagctcccgggatgtgttc
tccatttccaccctggtgtgctccacaaagctcactcagaatgtgggcttgctgggtttg
ctgaagtggcgtatgaagcctcaactgctacaggagaatttagaaaagttgaagattgtg
gatggagaggaagtggtgaagtttctccaggatactctggatgccctcttcaacatcatg
atggagcattctcaaagtgatgaatatgacatcctcgtctttgatgccttgatttacata
ataggactcattgcagaccggaaatttcagcatttcaacaccgttctggaggcttacatc
caacagcatttcagtgcgaccttggcttacaagaaattgatgacagtgctgaagacttac
ttggatacctccagcagaggggagcaatgtgagccaatcctaagaacgctgaaggctttg
gaatatgtgttcaagttcattgttcggtcgaggacattattttcacagctttatgaaggc
aaagaacagatggagtttgaagaatccatgagacggctctttgaatccatcaacaatctg
atgaaaagtcaatacaaaactaccatccttttgcaggtggcggctttgaaatacatccca
tctgtcctgcatgatgtagaaatggtctttgatgcgaagttactcagccaactcctgtat
gagttctacacctgcatccctcctgtgaaactccagaagcagaaagtacagtctatgaat
gagatagtccagagcaacctctttaaaaagcaagaatgccgggacattctgcttcctgtc
atcaccaaagagctgaaggagctgctggagcagaaggatgacatgcaacaccaggtcctg
gagaggaagtactgcgttgaattgctcaacagcatcttggaagtccttagctaccaggat
gcggccttcacctaccaccatatccaggagatcatggtccagctgctgcggacagtgaac
cggacagtcatcaccatgggccgggatcacattctgattagtcactttgtggcatgtatg
acagccatcttaaaccagatgggtgaccagcactactccttctacattgagaccttccag
accagctctgaacttgtggacttcttgatggagaccttcatcatgttcaaggacctcatt
ggaaagaacgtgtaccctggagactggatggccatgagcatggttcaaaacagggtcttc
ctgagagctatcaacaagtttgcagaaaccatgaaccagaagttcctagaacacacgaac
tttgagttccagctgtggaacaactattttcatctggcagtggcttttatcacccaggat
tctctgcagctggagcagttctcacacgccaaatacaacaaaatcctgaataagtatggg
gacatgagacggctaattggcttctccatccgtgatatgtggtacaagcttggtcagaac
aaaatctgcttcatcccaggcatggtaggacctatattagagatgacacttatccctgag
gctgagctccggaaagccaccataccaatcttcttcgacatgatgctgtgtgaatatcaa
agaagtggggatttcaaaaagtttgaaaacgaaatcatcctgaagctggaccacgaggta
gaagggggccgaggcgacgagcagtacatgcagctcctggagtcaatcctgatggaatgt
gctgcagagcacccaaccattgccaagtcggtggagaacttcgtgaacctggtcaaaggc
ctcctggagaagctgctggattaccggggtgtgatgacagatgagagcaaagacaaccgc
atgagctgcaccgtgaacctgctgaatttctacaaagataacaacagggaggagatgtac
ataaggtacctgtacaaactccgcgatcttcacctggactgtgacaattacacagaggct
gcctacacgctccttctccacacctggcttctcaagtggtcggatgagcagtgtgcatca
caggtcatgcagacaggccagcagcacccccagacacaccggcagctgaaggagacgctc
tacgagaccatcataggctactttgacaaaggaaagatgtgggaagaggccataagtctg
tgcaaggagctggcggaacagtacgagatggagatctttgactatgagctgctcagccag
aacctgatccagcaggcaaaattctatgaaagcatcatgaaaatcctcaggcccaaacca
gactactttgctgttggatactacggccagggattcccctccttcctgcggaacaaagtg
ttcatctaccgcgggaaggaatatgagcgaagagaagatttccagatgcagctgatgacc
cagttccccaatgcagagaagatgaacaccacctctgccccgggagatgatgtgaagaat
gccccaggccagtatatccagtgcttcactgtccagcctgtcttggatgaacatcccagg
ttcaagaataagccagtgcctgaccagattataaacttctacaaatccaactacgtgcaa
aggttccactactcccggcccgtgcgcagggggaccgtagacccagagaatgagtttgct
tccatgtggattgagagaacctccttcgtgactgcatacaagctgccggggatcctgcgc
tggtttgaggtggtgcacatgtcgcagaccacaattagtcctctggagaatgccatagaa
accatgtccacggccaatgagaagatcctgatgatgataaaccagtaccagagtgatgag
accctccccatcaacccactctccatgctcctgaacgggattgtggaccctgctgtcatg
ggaggcttcgccaagtatgagaaggccttcttcactgaagagtatgtcagggaccaccct
gaggaccaggacaagctgacccacctcaaggacctgattgcatggcagatccccttcttg
ggagctgggattaagatccatgagaaaagggtgtcagataacttgcgacccttccatgac
cggatggaggaatgtttcaagaacctgaaaatgaaggtggagaaggagtacggtgtccga
gagatgcctgactttgacgacaggagagtgggccgtcccaggtctatgctgcgctcatac
agacagatgtccatcatctctctggcttccatgaattctgactgcagcacccccagcaag
cctacctcagagagctttgacctggaattagcatcacccaagacgccgagagtggagcag
gaggaaccgatctccccggggagcaccctgcctgaggtcaagctgcggaggtccaagaag
aggacaaagagaagcagcgtagtttttgcggatgagaaagcagctgcagagtcggacctg
aagcggctttccaggaagcatgagttcatgagtgacaccaacctctcggagcatgcggcc
atccccctcaaggcgtctgtcctctctcaaatgagctttgccagccagtccatgcctacc
atcccagccctggcgctctcagtggcaggcatccctgggttggatgaggccaacacatct
ccccgcctcagccagaccttcctccaactctcagatggtgacaagaagacactcacacgg
aagaaggtcaatcagttcttcaagacaatgctggccagcaaatcggctgaagaaggcaaa
cagatcccagactcgctgtccacggacctgtga

DBGET integrated database retrieval system