KEGG   Homo sapiens (human): 1812
Entry
1812              CDS       T01001                                 

Gene name
DRD1, DADR, DRD1A
Definition
(RefSeq) dopamine receptor D1
  KO
K04144  dopamine receptor D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00410  DRD1-GNAS-AC-PKA signaling pathway
Drug target
Acepromazine (DG00870): D02604 D07065
Acetophenazine (DG00878): D00788
Adrogolide hydrochloride: D02775
Apomorphine (DG00486): D02004<JP/US> D07460
Butaclamol hydrochloride: D02641
Carphenazine maleate: D02644
Chlorprothixene (DG00894): D00790 D02162 D07686 D07687
Ciladopa hydrochloride: D03494
Clopenthixol: D02613
Dexpramipexole (DG01331): D09886 D09887
Docarpamine: D01903<JP>
Dopamine (DG00213): D00633<JP/US> D07870
Dopexamine (DG00222): D03891 D03892
Ecopipam hydrochloride: D03937
Etilevodopa: D04097
Fenoldopam (DG00226): D00613<US> D07946
Flupentixol (DG00893): D01044 D02236 D07976
Foslevodopa: D11839
Ibopamine (DG00223): D04488 D08057
Levodopa: D00059<JP/US>
Mevidalen (DG03111): D11822 D11826
Oxiperomide: D02676
Pergolide (DG00861): D00502<JP> D08339
Pipotiazine (DG00884): D02680 D08385
Tavapadon: D11431
Tiotixene (DG00895): D00374<US> D02612
Zicronapine (DG01539): D10329 D10495
Zuclopenthixol (DG00896): D03556 D08691 D08692 D08693
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1812 (DRD1)
   04024 cAMP signaling pathway
    1812 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1812 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1812 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1812 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    1812 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    1812 (DRD1)
   05031 Amphetamine addiction
    1812 (DRD1)
   05032 Morphine addiction
    1812 (DRD1)
   05034 Alcoholism
    1812 (DRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1812 (DRD1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1812 (DRD1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1812
NCBI-ProteinID: NP_000785
OMIM: 126449
HGNC: 3020
Ensembl: ENSG00000184845
Vega: OTTHUMG00000130557
Pharos: P21728(Tclin)
UniProt: P21728
LinkDB
Position
5q35.2
AA seq 446 aa
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggacgggactgggctggtggtggagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgccgttatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagatctcttggtggccgtcctggtcatgccctgg
aaggcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccactgcatccatcctcaacctctgtgtgatcagcgtggac
aggtattgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccacaagcccctctgatggaaatgccacttccctggct
gagaccatagacaactgtgactccagcctcagcaggacatatgccatctcatcctctgta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcggccttggagagggcagcagtccacgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcggtgatcatgggtgtg
tttgtgtgctgttggctacctttcttcatcttgaactgcattttgcccttctgtgggtct
ggggagacgcagcccttctgcattgattccaacacctttgacgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgccctgcgacgaataatgccatagagacg
gtgagtatcaataacaatggggccgcgatgttttccagccatcatgagccacgaggctcc
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggcatcgccagacccttggagaagctgtccccagcccta
tcagtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggtcagcacccaacctga

KEGG   Homo sapiens (human): 1813
Entry
1813              CDS       T01001                                 

Gene name
DRD2, D2DR, D2R
Definition
(RefSeq) dopamine receptor D2
  KO
K04145  dopamine receptor D2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05034  Alcoholism
Disease
H01611  Alcohol dependence
Drug target
Acepromazine (DG00870): D02604 D07065
Acetophenazine (DG00878): D00788
Alentemol hydrobromide: D02634
Alizapride (DG00058): D07102 D07563
Amisulpride: D07310<US>
Aplindore fumarate: D03214
Apomorphine (DG00486): D02004<JP/US> D07460
Aripiprazole (DG00906): D01164<JP/US> D10355 D10364<US> D10516<JP/US>
Asenapine (DG03100): D02995<JP/US> D11769<US>
Benperidol: D02627
Bifeprunox (DG01304): D06566 D06567
Blonanserin: D01176<JP>
Brexpiprazole: D10309<JP/US>
Bromocriptine (DG00452): D00780<JP/US> D03165
Bromopride: D07101
Bromperidol (DG00890): D01101<JP> D02626
Buspirone (DG00913): D00702<US> D07593
Butaclamol hydrochloride: D02641
Cabergoline: D00987<JP/US>
Cariprazine (DG01305): D09876<US> D09997
Carphenazine maleate: D02644
Carvotroline hydrochloride: D02645
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Chlorprothixene (DG00894): D00790 D02162 D07686 D07687
Ciladopa hydrochloride: D03494
Clebopride (DG00059): D01742 D03534
Clocapramine (DG01313): D02371<JP> D07718
Clopenthixol: D02613
Dexpramipexole (DG01331): D09886 D09887
Dihydroergocryptine (DG01329): D07835
Dihydroergocryptine mesylate: D07836
Domperidone (DG00057): D01745<JP> D07868
Dopamine (DG00213): D00633<JP/US> D07870
Dopexamine (DG00222): D03891 D03892
Droperidol: D00308<JP/US>
Etilevodopa: D04097
Flupentixol (DG00893): D01044 D02236 D07976
Fluphenazine (DG00874): D00791<US> D00792 D00793<JP/US> D02163<JP> D07977
Foslevodopa: D11839
Haloperidol (DG00885): D00136<JP/US> D01898<JP/US> D08035<US>
Ibopamine (DG00223): D04488 D08057
Iloperidone: D02666<US>
Itopride (DG01395): D02729<JP> D08094
Lergotrile (DG01319): D04693 D04694
Levodopa: D00059<JP/US>
Levomepromazine (DG00868): D00403 D01520<JP> D02248<JP>
Levosulpiride: D07312
Lisuride (DG00453): D01462 D08132
Loxapine (DG00897): D00794<US> D02340<US> D08148
Lumateperone (DG02937): D11169 D11170<US>
Lurasidone: D04820<JP/US>
Mazapertine succinate: D02670
Melperone (DG00887): D07309 D08172
Mesoridazine (DG00883): D00795 D02671
Methoxypromazine maleate: D02605
Metoclopramide (DG00055): D00726<JP> D02213<JP/US> D05008<US>
Metopimazine: D05010
Molindone (DG00891): D00796<US> D08226
Moperone (DG00888): D01105 D02623
Mosapramine (DG00905): D01548<JP> D08235
Naxagolide hydrochloride: D05124
Nemonapride: D01468<JP>
Ocaperidone: D02675
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Opipramol (DG00930): D01477 D08297
Oxiperomide: D02676
Paliperidone (DG00907): D05339<JP/US> D05340<JP/US>
Pardoprunox (DG01324): D09366 D09397
Perazine (DG00881): D01412 D01860 D02608
Pergolide (DG00861): D00502<JP> D08339
Periciazine: D01485<JP>
Perospirone hydrochloride hydrate: D02372<JP>
Perphenazine (DG00875): D00503<JP/US> D02037<JP> D04038<JP> D04965<JP> D08341 D08342
Pimozide: D00560<JP/US>
Pipamperone (DG00889): D01482<JP> D02622
Pipotiazine (DG00884): D02680 D08385
Piquindone hydrochloride: D02681
Piribedil: D07305
Pramipexole (DG00863): D00559<JP/US> D05575
Pridopidine (DG01325): D09953 D09954
Prochlorperazine (DG00876): D00479<JP/US> D00493<US> D02022<JP> D02609<US>
Promazine (DG00869): D00797 D08430
Quetiapine (DG00899): D00458<JP/US> D08456
Quinagolide (DG00454): D07217 D08457
Quinelorane hydrochloride: D05677
Quinpirole hydrochloride: D05682
Raclopride C11: D05690
Remoxipride (DG00902): D02682 D02683
Risperidone: D00426<JP/US>
Ropinirole (DG00862): D00784<JP/US> D08489
Rotigotine: D05768<JP/US>
Sarizotan hydrochloride: D05804
Sertindole: D00561
Sibenadet hydrochloride: D05832
Spiperone: D01051<JP>
Sulpiride: D01226<JP>
Sultopride (DG00900): D02208<JP> D08549
Talipexole (DG01326): D01505<JP> D08558
Terguride: D01348
Thiethylperazine (DG01102): D01130 D02354 D02610
Thioproperazine (DG00879): D01447 D08585
Thioridazine (DG00882): D00373 D00798<US>
Tiapride (DG00901): D01522<JP> D08590
Timiperone: D02035<JP>
Tiospirone hydrochloride: D02688
Tiotixene (DG00895): D00374<US> D02612
Trifluoperazine (DG00877): D00799<US> D01448 D08636
Trifluperidol (DG00886): D02625 D08637
Triflupromazine (DG00871): D00390 D00800
Zicronapine (DG01539): D10329 D10495
Ziprasidone (DG00892): D01939<US> D02100<US> D08687
Zotepine: D01321<JP>
Zuclopenthixol (DG00896): D03556 D08691 D08692 D08693
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1813 (DRD2)
   04024 cAMP signaling pathway
    1813 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1813 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1813 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1813 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    1813 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    1813 (DRD2)
   05034 Alcoholism
    1813 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1813 (DRD2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1813 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv DUF2207 RIFIN Stevor
Other DBs
NCBI-GeneID: 1813
NCBI-ProteinID: NP_000786
OMIM: 126450
HGNC: 3023
Ensembl: ENSG00000149295
Vega: OTTHUMG00000167717
Pharos: P14416(Tclin)
UniProt: P14416 A0A024R3C5
LinkDB
Position
11q23.2
AA seq 443 aa
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtatgatgatgatctggagaggcagaactggagccgg
cccttcaacgggtcagacgggaaggcggacagaccccactacaactactatgccacactg
ctcaccctgctcatcgctgtcatcgtcttcggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgcagtggccgac
ctcctcgtcgccacactggtcatgccctgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcatcctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgccgggtcaccgtcatgatctccatcgtctgg
gtcctgtccttcaccatctcctgcccactcctcttcggactcaataacgcagaccagaac
gagtgcatcattgccaacccggccttcgtggtctactcctccatcgtctccttctacgtg
cccttcattgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacaccaaacgcagcagccgagctttcagggcccacctgagggctccacta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccaccc
agccaccaccagctgactctccccgacccgtcccaccatggtctccacagcactcccgac
agccccgccaaaccagagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctcccagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccgcctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

KEGG   Homo sapiens (human): 1814
Entry
1814              CDS       T01001                                 

Gene name
DRD3, D3DR, ETM1, FET1
Definition
(RefSeq) dopamine receptor D3
  KO
K04146  dopamine receptor D3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01649  Schizophrenia
Drug target
Amisulpride: D07310<US>
Aplindore fumarate: D03214
Aripiprazole (DG00906): D01164<JP/US> D10355 D10364<US> D10516<JP/US>
Blonanserin: D01176<JP>
Captodiame: D07316
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633<JP/US> D07870
Dopexamine (DG00222): D03891 D03892
Etilevodopa: D04097
Foslevodopa: D11839
Levodopa: D00059<JP/US>
Lisuride (DG00453): D01462 D08132
Mosapramine (DG00905): D01548<JP> D08235
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Oxiperomide: D02676
Pardoprunox (DG01324): D09366 D09397
Pimozide: D00560<JP/US>
Piribedil: D07305
Pramipexole (DG00863): D00559<JP/US> D05575
Quinpirole hydrochloride: D05682
Ropinirole (DG00862): D00784<JP/US> D08489
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1814 (DRD3)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1814 (DRD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1814 (DRD3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1814 (DRD3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 MAP65_ASE1
Other DBs
NCBI-GeneID: 1814
NCBI-ProteinID: NP_000787
OMIM: 126451
HGNC: 3024
Ensembl: ENSG00000151577
Vega: OTTHUMG00000159334
Pharos: P35462(Tclin)
UniProt: P35462 X5D2G4 A8K8E4
LinkDB
Position
3q13.31
AA seq 400 aa
MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcatctctgagccagctgagtggccacctgaactacacctgtggggcagagaactcc
acaggtgccagccaggcccgcccacatgcctactatgccctctcctactgcgcgctcatc
ctggccatcgtcttcggcaatggcctggtgtgcatggctgtgctgaaggagcgggccctg
cagactaccaccaactacttagtagtgagcctggctgtggcagacttgctggtggccacc
ttggtgatgccctgggtggtatacctggaggtgacaggtggagtctggaatttcagccgc
atttgctgtgatgtttttgtcaccctggatgtcatgatgtgtacagccagcatccttaat
ctctgtgccatcagcatagacaggtacactgcagtggtcatgcccgttcactaccagcat
ggcacgggacagagctcctgtcggcgcgtggccctcatgatcacggccgtctgggtactg
gcctttgctgtgtcctgccctcttctgtttggctttaataccacaggggaccccactgtc
tgctccatctccaaccctgattttgtcatctactcttcagtggtgtccttctacctgccc
tttggagtgactgtccttgtctatgccagaatctatgtggtgctgaaacaaaggagacgg
aaaaggatcctcactcgacagaacagtcagtgcaacagtgtcaggcctggcttcccccag
caaaccctctctcctgacccggcacatctggagctgaagcgttactacagcatctgccag
gacactgccttgggtggaccaggcttccaagaaagaggaggagagttgaaaagagaggag
aagactcggaattccctgagtcccaccatagcgcccaagctcagcttagaagttcgaaaa
ctcagcaatggcagattatcgacatctttgaagctggggcccctgcaacctcggggagtg
ccacttcgggagaagaaggcaacccaaatggtggccattgtgcttggggccttcattgtc
tgctggctgcccttcttcttgacccatgttctcaatacccactgccagacatgccacgtg
tccccagagctttacagtgccacgacatggctgggctacgtgaatagcgccctcaaccct
gtgatctataccaccttcaatatcgagttccggaaagccttcctcaagatcctgtcttgc
tga

KEGG   Homo sapiens (human): 1815
Entry
1815              CDS       T01001                                 

Gene name
DRD4, D4DR
Definition
(RefSeq) dopamine receptor D4
  KO
K04147  dopamine receptor D4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01450  Obsessive-compulsive disorder
H01671  Neurosis
H01895  Attention deficit hyperactivity disorder (ADHD)
Drug target
Clozapine: D00283<JP/US>
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633<JP/US> D07870
Dopexamine (DG00222): D03891 D03892
Etilevodopa: D04097
Fananserin: D02656
Foslevodopa: D11839
Levodopa: D00059<JP/US>
Lisuride (DG00453): D01462 D08132
Mosapramine (DG00905): D01548<JP> D08235
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Oxiperomide: D02676
Pramipexole (DG00863): D00559<JP/US> D05575
Ropinirole (DG00862): D00784<JP/US> D08489
Sonepiprazole mesylate: D05891
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1815 (DRD4)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1815 (DRD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1815 (DRD4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1815 (DRD4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1815
NCBI-ProteinID: NP_000788
OMIM: 126452
HGNC: 3025
Ensembl: ENSG00000069696
Vega: OTTHUMG00000133312
Pharos: P21917(Tchem)
UniProt: P21917
LinkDB
Position
11p15.5
AA seq 419 aa
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggggaaccgcagcaccgcggacgcggacgggctgctggctgggcgcgggccggccgcg
ggggcatctgcgggggcatctgcggggctggctgggcagggcgcggcggcgctggtgggg
ggcgtgctgctcatcggcgcggtgctcgcggggaactcgctcgtgtgcgtgagcgtggcc
accgagcgcgccctgcagacgcccaccaactccttcatcgtgagcctggcggccgccgac
ctcctcctcgctctcctggtgctgccgctcttcgtctactccgaggtccagggtggcgcg
tggctgctgagcccccgcctgtgcgacgccctcatggccatggacgtcatgctgtgcacc
gcctccatcttcaacctgtgcgccatcagcgtggacaggttcgtggccgtggccgtgccg
ctgcgctacaaccggcagggtgggagccgccggcagctgctgctcatcggcgccacgtgg
ctgctgtccgcggcggtggcggcgcccgtactgtgcggcctcaacgacgtgcgcggccgc
gaccccgccgtgtgccgcctggaggaccgcgactacgtggtctactcgtccgtgtgctcc
ttcttcctaccctgcccgctcatgctgctgctctactgggccacgttccgcggcctgcag
cgctgggaggtggcacgtcgcgccaagctgcacggccgcgcgccccgccgacccagcggc
cctggcccgccttcccccacgccacccgcgccccgcctcccccaggacccctgcggcccc
gactgtgcgccccccgcgcccggccttccccggggtccctgcggccccgactgtgcgccc
gccgcgcccagcctcccccaggacccctgcggccccgactgtgcgccccccgcgcccggc
ctccccccggacccctgcggctccaactgtgctccccccgacgccgtcagagccgccgcg
ctcccaccccagactccaccgcagacccgcaggaggcggcgtgccaagatcaccggccgg
gagcgcaaggccatgagggtcctgccggtggtggtcggggccttcctgctgtgctggacg
cccttcttcgtggtgcacatcacgcaggcgctgtgtcctgcctgctccgtgcccccgcgg
ctggtcagcgccgtcacctggctgggctacgtcaacagcgccctcaaccccgtcatctac
actgtcttcaacgccgagttccgcaacgtcttccgcaaggccctgcgtgcctgctgctga

KEGG   Homo sapiens (human): 1816
Entry
1816              CDS       T01001                                 

Gene name
DRD5, DBDR, DRD1B, DRD1L2
Definition
(RefSeq) dopamine receptor D5
  KO
K05840  dopamine receptor D5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01895  Attention deficit hyperactivity disorder (ADHD)
Drug target
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633<JP/US> D07870
Dopexamine (DG00222): D03891 D03892
Ecopipam hydrochloride: D03937
Etilevodopa: D04097
Foslevodopa: D11839
Levodopa: D00059<JP/US>
Oxiperomide: D02676
Tavapadon: D11431
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1816 (DRD5)
   04024 cAMP signaling pathway
    1816 (DRD5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1816 (DRD5)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1816 (DRD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1816 (DRD5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1816 (DRD5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1816
NCBI-ProteinID: NP_000789
OMIM: 126453
HGNC: 3026
Ensembl: ENSG00000169676
Vega: OTTHUMG00000128489
Pharos: P21918(Tchem)
UniProt: P21918
LinkDB
Position
4p16.1
AA seq 477 aa
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgctgccgccaggcagcaacggcaccgcgtacccggggcagttcgctctataccagcag
ctggcgcaggggaacgccgtggggggctcggcgggggcaccgccactggggccctcacag
gtggtcaccgcctgcctgctgaccctactcatcatctggaccctgctgggcaacgtgctg
gtgtgcgcagccatcgtgcggagccgccacctgcgcgccaacatgaccaacgtcttcatc
gtgtctctggccgtgtcagaccttttcgtggcgctgctggtcatgccctggaaggcagtc
gccgaggtggccggttactggccctttggagcgttctgcgacgtctgggtggccttcgac
atcatgtgctccactgcctccatcctgaacctgtgcgtcatcagcgtggaccgctactgg
gccatctccaggcccttccgctacaagcgcaagatgactcagcgcatggccttggtcatg
gtcggcctggcatggaccttgtccatcctcatctccttcattccggtccagctcaactgg
cacagggaccaggcggcctcttggggcgggctggacctgccaaacaacctggccaactgg
acgccctgggaggaggacttttgggagcccgacgtgaatgcagagaactgtgactccagc
ctgaatcgaacctacgccatctcttcctcgctcatcagcttctacatccccgttgccatc
atgatcgtgacctacacgcgcatctaccgcatcgcccaggtgcagatccgcaggatttcc
tccctggagagggccgcagagcacgcgcagagctgccggagcagcgcagcctgcgcgccc
gacaccagcctgcgcgcttccatcaagaaggagaccaaggttctcaagaccctgtcggtg
atcatgggggtcttcgtgtgttgctggctgcccttcttcatccttaactgcatggtccct
ttctgcagtggacaccccgaaggccctccggccggcttcccctgcgtcagtgagaccacc
ttcgacgtcttcgtctggttcggctgggctaactcctcactcaaccccgtcatctatgcc
ttcaacgccgactttcagaaggtgtttgcccagctgctggggtgcagccacttctgctcc
cgcacgccggtggagacggtgaacatcagcaatgagctcatctcctacaaccaagacatc
gtcttccacaaggaaatcgcagctgcctacatccacatgatgcccaacgccgttaccccc
ggcaaccgggaggtggacaacgacgaggaggagggtcctttcgatcgcatgttccagatc
tatcagacgtccccagatggtgaccctgttgctgagtctgtctgggagctggactgcgag
ggggagatttctttagacaaaataacacctttcaccccgaatggattccattaa

DBGET integrated database retrieval system