KEGG   Homo sapiens (human): 1813
Entry
1813              CDS       T01001                                 

Gene name
DRD2, D2DR, D2R
Definition
(RefSeq) dopamine receptor D2
  KO
K04145  dopamine receptor D2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05034  Alcoholism
Disease
H01611  Alcohol dependence
Drug target
Acepromazine (DG00870): D02604 D07065
Acetophenazine (DG00878): D00788
Alentemol hydrobromide: D02634
Alizapride (DG00058): D07102 D07563
Amisulpride: D07310<US>
Aplindore fumarate: D03214
Apomorphine (DG00486): D02004<JP/US> D07460
Aripiprazole (DG00906): D01164<JP/US> D10355 D10364<US> D10516<JP/US>
Asenapine (DG03100): D02995<JP/US> D11769<US>
Benperidol: D02627
Bifeprunox (DG01304): D06566 D06567
Blonanserin: D01176<JP>
Brexpiprazole: D10309<JP/US>
Bromocriptine (DG00452): D00780<JP/US> D03165
Bromopride: D07101
Bromperidol (DG00890): D01101<JP> D02626
Buspirone (DG00913): D00702<US> D07593
Butaclamol hydrochloride: D02641
Cabergoline: D00987<JP/US>
Cariprazine (DG01305): D09876<US> D09997
Carphenazine maleate: D02644
Carvotroline hydrochloride: D02645
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Chlorprothixene (DG00894): D00790 D02162 D07686 D07687
Ciladopa hydrochloride: D03494
Clebopride (DG00059): D01742 D03534
Clocapramine (DG01313): D02371<JP> D07718
Clopenthixol: D02613
Dexpramipexole (DG01331): D09886 D09887
Dihydroergocryptine (DG01329): D07835
Dihydroergocryptine mesylate: D07836
Domperidone (DG00057): D01745<JP> D07868
Dopamine (DG00213): D00633<JP/US> D07870
Dopexamine (DG00222): D03891 D03892
Droperidol: D00308<JP/US>
Etilevodopa: D04097
Flupentixol (DG00893): D01044 D02236 D07976
Fluphenazine (DG00874): D00791<US> D00792 D00793<JP/US> D02163<JP> D07977
Foslevodopa: D11839
Haloperidol (DG00885): D00136<JP/US> D01898<JP/US> D08035<US>
Ibopamine (DG00223): D04488 D08057
Iloperidone: D02666<US>
Itopride (DG01395): D02729<JP> D08094
Lergotrile (DG01319): D04693 D04694
Levodopa: D00059<JP/US>
Levomepromazine (DG00868): D00403 D01520<JP> D02248<JP>
Levosulpiride: D07312
Lisuride (DG00453): D01462 D08132
Loxapine (DG00897): D00794<US> D02340<US> D08148
Lumateperone (DG02937): D11169 D11170<US>
Lurasidone: D04820<JP/US>
Mazapertine succinate: D02670
Melperone (DG00887): D07309 D08172
Mesoridazine (DG00883): D00795 D02671
Methoxypromazine maleate: D02605
Metoclopramide (DG00055): D00726<JP> D02213<JP/US> D05008<US>
Metopimazine: D05010
Molindone (DG00891): D00796<US> D08226
Moperone (DG00888): D01105 D02623
Mosapramine (DG00905): D01548<JP> D08235
Naxagolide hydrochloride: D05124
Nemonapride: D01468<JP>
Ocaperidone: D02675
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Opipramol (DG00930): D01477 D08297
Oxiperomide: D02676
Paliperidone (DG00907): D05339<JP/US> D05340<JP/US>
Pardoprunox (DG01324): D09366 D09397
Perazine (DG00881): D01412 D01860 D02608
Pergolide (DG00861): D00502<JP> D08339
Periciazine: D01485<JP>
Perospirone hydrochloride hydrate: D02372<JP>
Perphenazine (DG00875): D00503<JP/US> D02037<JP> D04038<JP> D04965<JP> D08341 D08342
Pimozide: D00560<JP/US>
Pipamperone (DG00889): D01482<JP> D02622
Pipotiazine (DG00884): D02680 D08385
Piquindone hydrochloride: D02681
Piribedil: D07305
Pramipexole (DG00863): D00559<JP/US> D05575
Pridopidine (DG01325): D09953 D09954
Prochlorperazine (DG00876): D00479<JP/US> D00493<US> D02022<JP> D02609<US>
Promazine (DG00869): D00797 D08430
Quetiapine (DG00899): D00458<JP/US> D08456
Quinagolide (DG00454): D07217 D08457
Quinelorane hydrochloride: D05677
Quinpirole hydrochloride: D05682
Raclopride C11: D05690
Remoxipride (DG00902): D02682 D02683
Risperidone: D00426<JP/US>
Ropinirole (DG00862): D00784<JP/US> D08489
Rotigotine: D05768<JP/US>
Sarizotan hydrochloride: D05804
Sertindole: D00561
Sibenadet hydrochloride: D05832
Spiperone: D01051<JP>
Sulpiride: D01226<JP>
Sultopride (DG00900): D02208<JP> D08549
Talipexole (DG01326): D01505<JP> D08558
Terguride: D01348
Thiethylperazine (DG01102): D01130 D02354 D02610
Thioproperazine (DG00879): D01447 D08585
Thioridazine (DG00882): D00373 D00798<US>
Tiapride (DG00901): D01522<JP> D08590
Timiperone: D02035<JP>
Tiospirone hydrochloride: D02688
Tiotixene (DG00895): D00374<US> D02612
Trifluoperazine (DG00877): D00799<US> D01448 D08636
Trifluperidol (DG00886): D02625 D08637
Triflupromazine (DG00871): D00390 D00800
Zicronapine (DG01539): D10329 D10495
Ziprasidone (DG00892): D01939<US> D02100<US> D08687
Zotepine: D01321<JP>
Zuclopenthixol (DG00896): D03556 D08691 D08692 D08693
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1813 (DRD2)
   04024 cAMP signaling pathway
    1813 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1813 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1813 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1813 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    1813 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    1813 (DRD2)
   05034 Alcoholism
    1813 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1813 (DRD2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1813 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv DUF2207 RIFIN Stevor
Other DBs
NCBI-GeneID: 1813
NCBI-ProteinID: NP_000786
OMIM: 126450
HGNC: 3023
Ensembl: ENSG00000149295
Vega: OTTHUMG00000167717
Pharos: P14416(Tclin)
UniProt: P14416 A0A024R3C5
LinkDB
Position
11q23.2
AA seq 443 aa
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtatgatgatgatctggagaggcagaactggagccgg
cccttcaacgggtcagacgggaaggcggacagaccccactacaactactatgccacactg
ctcaccctgctcatcgctgtcatcgtcttcggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgcagtggccgac
ctcctcgtcgccacactggtcatgccctgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcatcctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgccgggtcaccgtcatgatctccatcgtctgg
gtcctgtccttcaccatctcctgcccactcctcttcggactcaataacgcagaccagaac
gagtgcatcattgccaacccggccttcgtggtctactcctccatcgtctccttctacgtg
cccttcattgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacaccaaacgcagcagccgagctttcagggcccacctgagggctccacta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccaccc
agccaccaccagctgactctccccgacccgtcccaccatggtctccacagcactcccgac
agccccgccaaaccagagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctcccagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccgcctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

DBGET integrated database retrieval system