KEGG   Homo sapiens (human): 1827Help
Entry
1827              CDS       T01001                                 

Gene name
RCAN1, ADAPT78, CSP1, DSC1, DSCR1, MCIP1, RCN1
Definition
(RefSeq) regulator of calcineurin 1
  KO
K17901  calcipressin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Disease
H01552  Down syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    1827 (RCAN1)
   04919 Thyroid hormone signaling pathway
    1827 (RCAN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    1827 (RCAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1827 (RCAN1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    1827 (RCAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calcipressin
Motif
Other DBs
NCBI-GeneID: 1827
NCBI-ProteinID: NP_004405
OMIM: 602917
HGNC: 3040
Ensembl: ENSG00000159200
Vega: OTTHUMG00000086235
Pharos: P53805(Tbio)
UniProt: P53805
LinkDB All DBs
Position
21q22.12
AA seq 252 aa AA seqDB search
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVD
LQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAA
DARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATP
VINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQ
TRRPEYTPIHLS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggcgtggccggtccccagctcggggccgcggcggaggcggcggaggcggcc
gaggcgcgagcgcggcccggggtgacgctgcggcccttcgcgcccctctcgggggcggcc
gaggcggacgagggcggcggcgactggagcttcattgactgcgagatggaggaggtggac
ctgcaggacctgcccagcgccaccatcgcctgtcacctggacccgcgcgtgttcgtggac
ggcctgtgccgggccaaatttgagtccctctttaggacgtatgacaaggacatcaccttt
cagtattttaagagcttcaaacgagtcagaataaacttcagcaaccccttctccgcagca
gatgccaggctccagctgcataagactgagtttctgggaaaggaaatgaagttatatttt
gctcagaccttacacataggaagctcacacctggctccgccaaatccagacaagcagttt
ctgatctcccctcccgcctctccgccagtgggatggaaacaagtggaagatgcgacccca
gtcataaactatgatctcttatatgccatctccaagctggggccaggggaaaagtatgaa
ttgcacgcagcgactgacaccactcccagcgtggtggtccatgtatgtgagagtgatcaa
gagaaggaggaagaagaggaaatggaaagaatgaggagacctaagccaaaaattatccag
accaggaggccggagtacacgccgatccacctcagctga

DBGET integrated database retrieval system