KEGG   Homo sapiens (human): 1834Help
Entry
1834              CDS       T01001                                 

Gene name
DSPP, DFNA39, DGI1, DMP3, DPP, DSP
Definition
(RefSeq) dentin sialophosphoprotein
  KO
K23573  dentin sialophosphoprotein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Disease
H00432  Hereditary dentine disorders
H00604  Deafness, autosomal dominant
H02348  Dentin dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1834 (DSPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 1834
NCBI-ProteinID: NP_055023
OMIM: 125485
HGNC: 3054
Ensembl: ENSG00000152591
Vega: OTTHUMG00000161061
Pharos: Q9NZW4(Tbio)
UniProt: Q9NZW4
LinkDB All DBs
Position
4q22.1
AA seq 1301 aa AA seqDB search
MKIITYFCIWAVAWAIPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVL
VHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYG
HDGIHGKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQ
EDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEITPQINSKRNGTKEAEVTPGTGEDAGLD
NSDGSPSGNGADEDEDEGSGDDEDEEAGNGKDSSNNSKGQEGQDHGKEDDHDSSIGQNSD
SKEYYDPEGKEDPHNEVDGDKTSKSEENSAGIPEDNGSQRIEDTQKLNHRESKRVENRIT
KESETHAVGKSQDKGIEIKGPSSGNRNITKEVGKGNEGKEDKGQHGMILGKGNVKTQGEV
VNIEGPGQKSEPGNKVGHSNTGSDSNSDGYDSYDFDDKSMQGDDPNSSDESNGNDDANSE
SDNNSSSRGDASYNSDESKDNGNGSDSKGAEDDDSDSTSDTNNSDSNGNGNNGNDDNDKS
DSGKGKSDSSDSDSSDSSNSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSN
SSDSSDSSDSSDSSDSSDSSDSKSDSSKSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSS
NSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSN
SNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSS
NSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSD
SSDSSDSSDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSSDSSNS
SDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSS
DSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSD
SSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSD
SSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSN
SSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSD
SSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSSDSSD
STSDSNDESDSQSKSGNGNNNGSDSDSDSEGSDSNHSTSDD
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atgaagataattacatatttttgcatttgggcagtagcatgggccattccagttcctcaa
agcaaaccactggagagacatgtcgaaaaatccatgaatttgcatctcctagcaagatca
aatgtgtcagtacaggatgagttaaatgccagtggaaccatcaaagaaagtggtgtcctg
gtgcatgaaggtgatagaggaaggcaagagaatacccaagatggtcacaagggagaaggg
aatggctctaagtgggcagaagtaggagggaagagtttttctacatattccacattagca
aacgaagaggggaatattgagggctggaatggggacacaggaaaagcagaaacatatggt
catgatggaatacatgggaaagaagaaaacatcacagcaaatggcatccagggacaagta
agcatcattgacaatgctggagccacaaacagaagcaacactaatggaaatactgataag
aatacccaaaatggggatgttggcgatgcaggtcacaatgaggatgtcgctgttgtccaa
gaagatggacctcaagtagctggaagcaataacagtacagacaatgaggatgaaataatt
gagaattcctgtagaaacgagggtaatacaagtgaaataacacctcagatcaacagcaag
agaaatgggactaaggaagctgaggtaacaccaggcactggagaagatgctggcctggat
aattccgatgggagtcctagtgggaatggagcagatgaggatgaagacgagggttctggt
gatgatgaagatgaagaagcagggaatggaaaagacagtagtaataacagcaagggccag
gagggccaggaccatgggaaagaagatgatcatgatagtagcataggtcaaaattcagat
agtaaagaatattatgaccctgaaggcaaagaagatccccataatgaagttgatggagac
aagacctccaagagtgaggagaattctgctggtattccagaagacaatggcagccaaaga
atagaggacacccagaagctcaaccatagagaaagcaaacgcgtagaaaatagaatcacc
aaagaatcagagacacatgctgttgggaagagccaagataagggaatagaaatcaagggt
cccagcagtggcaacagaaatattaccaaagaagttgggaaaggcaacgaaggtaaagag
gataaaggacaacatggaatgatcttgggcaaaggcaatgtcaagacacaaggagaggtt
gtcaacatagaaggacctggccaaaaatcagaaccaggaaataaagttggacacagcaat
acaggtagtgacagcaatagtgatggatatgacagttatgattttgatgataagtccatg
caaggagatgatcccaatagcagtgatgaatctaatggcaatgatgatgctaattcagaa
agtgacaataacagcagtagccgaggagatgcttcttataactctgatgaatcaaaagat
aatggcaatggcagtgactcaaaaggagcagaagatgatgacagtgatagcacatcagac
actaataatagtgacagtaatggcaatggtaacaatgggaatgatgacaatgacaaatca
gacagtggcaaaggtaaatcagatagcagtgacagtgatagtagtgatagcagcaatagc
agtgatagtagtgacagcagtgacagtgacagcagtgatagcaacagtagcagtgatagt
gacagcagtgacagtgacagcagtgatagcagtgacagtgatagtagtgatagcagcaat
agcagtgacagtagtgacagcagtgatagcagtgacagtagtgatagtagtgacagcagt
gacagcaagtcagacagcagcaaatcagagagcgacagcagtgatagtgacagtaagtca
gacagcagtgacagcaacagcagtgacagtagtgacaacagtgatagcagcgacagcagc
aatagcagtaacagcagtgatagtagtgacagcagtgatagcagtgacagcagcagtagc
agtgacagcagcaacagcagtgatagtagtgacagtagtgacagcagcaatagcagtgag
agcagtgatagtagtgacagcagtgatagtgacagcagtgatagtagtgacagcagtaat
agtaacagcagcgatagtgacagcagcaacagcagcgatagcagtgacagcagcaacagc
agtgacagcagtgatagcagtgacagcagcaacagcagtgacagtagcgatagcagtgac
agcagcaacagcagtgacagcagtgatagcagtgacagcagtgatagtagtgacagcagc
aacagcagtgatagcaacgacagcagcaatagcagtgacagcagtgatagcagcaacagc
agtgatagcagcaacagcagtgatagcagtgatagcagtgacagcagtgatagcgacagc
agcaatagcagtgacagcagtaatagtagtgacagcagcgatagcagcaacagcagtgat
agcagcgacagcagcgatagcagtgacggcagtgatagcgacagcagcaatagaagtgac
agtagtaatagtagtgacagcagcgatagcagtgacagcagcaacagcagtgacagcagt
gatagcagtgacagcaacgaaagcagcaatagcagtgacagcagtgatagcagcaacagc
agtgatagtgacagcagtgatagcagcaacagcagtgacagcagtgatagcagcaacagc
agtgatagcagtgaaagcagtaatagtagtgacaacagcaatagcagtgacagcagcaac
agcagtgacagcagtgatagcagtgacagcagtaatagtagtgacagcagcaatagcagt
gacagcagcaacagcagtgacagcagtgatagcaatagcagcgacagcagtgacagcagc
aacagcagcgatagcagtgacagcagtgatagcagtgacagcagtgacagcagtgatagc
agcaacagcagtgatagcagtgacagcagtgacagcagtgatagcagtaatagtagtgac
agcagcaatagcagtgacagcagcaacagcagtgacagcagcgatagcagtgacagcagc
gatagcagtgacagcagcgatagcagtgacagcagtgacagcagcaatagcagtgacagc
agtgacagcagcgacagcagtgatagcagtgacagcagtgacagcagcgacagcagtgat
agcagtgaaagcagtgatagcagtgacagcagcaatagcagtgacagcagcgatagcagc
gacagcagcgacagcagcgatagcagtgacagcagcgatagcagtgacagcagtgacagc
agcaatagcagtgacagcagtgacagcagcgacagcagtgatagcagtgacagcagcaac
agcagtgacagcagtgacagcagtgaaagcagcgacagcagtgacagcagcgacagcagt
gacagcagcgatagcagcgacagcagcgacagcagcgatagcagtgacagcagcaatagc
agtgatagcagcgacagcagtgatagcagtgacagcagcgacagcagcgatagcagcgac
agcagcgatagtagtgatagcagtgacagcagtgacagcagcgacagcagtgacagcagc
gacagcagtgacagcagcgacagcagtgacagcaatgaaagcagcgacagcagtgacagc
agcgatagcagtgacagcagcaacagcagtgacagcagcgacagcagtgatagcagtgac
agcacatctgacagcaatgatgagagtgacagccagagcaagtctggtaacggtaacaac
aatggaagtgacagtgacagtgacagtgaaggcagtgacagtaaccactcaaccagtgat
gattag

DBGET integrated database retrieval system