KEGG   Homo sapiens (human): 1839Help
Entry
1839              CDS       T01001                                 

Gene name
HBEGF, DTR, DTS, DTSF, HEGFL
Definition
(RefSeq) heparin binding EGF like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05205  Proteoglycans in cancer
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    1839 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    1839 (HBEGF)
   04915 Estrogen signaling pathway
    1839 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    1839 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    1839 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    1839 (HBEGF)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1839 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1839 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1839 (HBEGF)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   1839 (HBEGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF
Motif
Other DBs
NCBI-GeneID: 1839
NCBI-ProteinID: NP_001936
OMIM: 126150
HGNC: 3059
Ensembl: ENSG00000113070
Vega: OTTHUMG00000129496
Pharos: Q99075(Tbio)
UniProt: Q99075
LinkDB All DBs
Structure
PDB: 

Position
5q31.3
AA seq 208 aa AA seqDB search
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagttctctcggcactg
gtgactggcgagagcctggagcggcttcggagagggctagctgctggaaccagcaacccg
gaccctcccactgtatccacggaccagctgctacccctaggaggcggccgggaccggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaaacaaggaggagcacgggaaaagaaagaagaaaggcaagggg
ctagggaagaagagggacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccacccgggttaccatgga
gagaggtgtcatgggctgagcctcccagtggaaaatcgcttatatacctatgaccacaca
accatcctggccgtggtggctgtggtgctgtcatctgtctgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggttatgatgtggaaaatgaagagaaagtg
aagttgggcatgactaattcccactga

DBGET integrated database retrieval system