KEGG   Homo sapiens (human): 1856Help
Entry
1856              CDS       T01001                                 

Gene name
DVL2
Definition
(RefSeq) dishevelled segment polarity protein 2
  KO
K02353  segment polarity protein dishevelled
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1856 (DVL2)
   04330 Notch signaling pathway
    1856 (DVL2)
   04390 Hippo signaling pathway
    1856 (DVL2)
   04150 mTOR signaling pathway
    1856 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1856 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    1856 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1856 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    1856 (DVL2)
   05226 Gastric cancer
    1856 (DVL2)
   05217 Basal cell carcinoma
    1856 (DVL2)
   05224 Breast cancer
    1856 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1856 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1856 (DVL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 1856
NCBI-ProteinID: NP_004413
OMIM: 602151
HGNC: 3086
Ensembl: ENSG00000004975
Vega: OTTHUMG00000102155
Pharos: O14641(Tbio)
UniProt: O14641
LinkDB All DBs
Structure
PDB: 

Position
17p13.1
AA seq 736 aa AA seqDB search
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtagcagcactgggggcggtggggttggggagacgaaggtgatttaccacctg
gatgaggaagagactccctacctggtgaagatccctgtccccgccgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggtggtatcctggctggtgtcctcagataatccccaacccgagatggcc
cctccagtccatgagcctcgggcagaactggcgcctccagccccacctttacctcctttg
ccacccgagaggaccagcggcattggggactcaaggcctccatccttccaccctaatgtg
tccagcagccatgagaatctggagcctgagacagaaaccgagtcagtagtgtcactgagg
cgggagcggcctcgcaggagagacagcagtgagcatggcgctgggggccacaggactggt
ggcccctcaaggctggagcgccacctggccggatacgagagctcctctaccctcatgacc
agcgagctggagagtaccagcctgggggactcggacgaggaggacaccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctccttaagcgccaccggcggcgaagg
aagcagaggccaccccgcctggagaggacgtcatccttcagcagcgtcacagattccaca
atgtctctcaatatcatcacagtcacgctaaacatggagaagtacaacttcctgggtatc
tccattgttggccagagcaatgagcggggagacggaggcatctacattggctccatcatg
aagggtggggctgtggcggccgacgggcgcattgagccaggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaacgatgacgctgtgcgggtgctgagggacatt
gtgcacaagcctggccccattgtgctgactgtggccaagtgctgggatccctctcctcag
gcctatttcactctcccccgaaatgagcccatccagccaattgaccctgctgcctgggtg
tcccattccgcggctctgactggcaccttcccagcctatccaggttcctcctccatgagc
accattacatctggatcgtctttgcctgatggctgtgaaggccggggtctctccgtccat
acggacatggcatcggtgaccaaggccatggcagctccagagtctggactggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgcctttctgggctcggatgtggttgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaagtatgccagc
gggctgctcaaagcaggcctgatccgacacaccgtcaacaagatcaccttctctgagcag
tgctattacgtcttcggagacctcagtggtggctgtgagagctacctagtcaacctgtct
ctcaatgacaacgatggctccagtggggcttcagaccaggataccctggctcctctgcct
ggggccaccccctggcccctgctgcccactttctcctaccaataccctgccccacacccc
tacagcccgcagcctccaccctaccatgagctttcatcttacacctatggtgggggcagt
gccagcagccagcatagtgagggcagccggagcagtgggtcgacacggagtgatgggggg
gcagggcgcacggggaggcccgaggagcgggcccccgagtccaagtccggcagtggcagt
gagtctgagccctccagccgagggggcagccttcggcggggtggggaagcaagtgggact
agcgatgggggccctcctccatccagaggctcaactgggggtgcccctaatctccgagcc
cacccagggctccatccctatggaccgccccctggcatggccctcccctacaaccccatg
atggtggtcatgatgcccccacctccacctccagtccctccagcagtgcagcctccgggg
gcccctccagtcagagacctgggctctgtgcccccagaactgacagccagccgccaaagc
ttccacatggccatgggcaatcccagcgagttctttgtggatgttatgtag

DBGET integrated database retrieval system