KEGG   Homo sapiens (human): 1870Help
Entry
1870              CDS       T01001                                 

Gene name
E2F2, E2F-2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04934  Cushing syndrome
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06272  Prostate cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
nt06360  Cushing syndrome
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00074  Loss of RB1 to cell cycle G1/S
N00075  Mutation-inactivated RB1 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  KSHV vCyclin to cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00170  KSHV LANA to cell cycle G1/S
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00255  Amplified CCNE to cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00275  Amplified CCND1 to cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00347  p300-p21-Cell cycle G1/S
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00358  HPV E6 to p21-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00360  HPV E7 to p27-cell cycle G1/S
N00361  HPV E7 to cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
N00420  HCMV IE2-86 to p21-cell cycle G1/S
N00421  HCMV IE2-86 to p21-cell cycle G1/S
N00422  HCMV IE2-86 to cell cycle G1/S
N00423  HCMV IE1-72 to cell cycle G1/S
N00424  HCMV pp71 to cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
N00483  EBV EBNA3C to cell cycle G1/S
N00484  EBV EBNA3C to cell cycle G1/S
N00494  HTLV-1 Tax to p16-cell cycle G1/S
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00521  HCV Core to p21-cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
N00537  HBV HBx to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1870 (E2F2)
   04218 Cellular senescence
    1870 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1870 (E2F2)
   05206 MicroRNAs in cancer
    1870 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    1870 (E2F2)
   05225 Hepatocellular carcinoma
    1870 (E2F2)
   05226 Gastric cancer
    1870 (E2F2)
   05214 Glioma
    1870 (E2F2)
   05220 Chronic myeloid leukemia
    1870 (E2F2)
   05218 Melanoma
    1870 (E2F2)
   05219 Bladder cancer
    1870 (E2F2)
   05215 Prostate cancer
    1870 (E2F2)
   05224 Breast cancer
    1870 (E2F2)
   05222 Small cell lung cancer
    1870 (E2F2)
   05223 Non-small cell lung cancer
    1870 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1870 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1870 (E2F2)
   05161 Hepatitis B
    1870 (E2F2)
   05160 Hepatitis C
    1870 (E2F2)
   05163 Human cytomegalovirus infection
    1870 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1870 (E2F2)
   05169 Epstein-Barr virus infection
    1870 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1870 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1870 (E2F2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1870 (E2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 1870
NCBI-ProteinID: NP_004082
OMIM: 600426
HGNC: 3114
Ensembl: ENSG00000007968
Vega: OTTHUMG00000003223
Pharos: Q14209(Tbio)
UniProt: Q14209
LinkDB All DBs
Position
1p36.12
AA seq 437 aa AA seqDB search
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggcttcggccgctgggcagaccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actgctacctactacacaccgctgtacccgcagacggcgcctcccgcagcggcgccaggc
acctgcctcgacgccactccccacggacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgtcgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacttcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggaaggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccaccagacctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacacg
gagcaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgttggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcctctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcaccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcctgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccatccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgatctcttcgactcctacgaccttggggacctgttgattaattga

DBGET integrated database retrieval system